Pith. sign in

REVIEW 4 major objections 6 minor 61 references

Analogy of space-time as an elastic medium -- Study of the perturbation tensor of the metric $h_{\mu\nu}$ through the prism of the analogy of the theory of elasticity -- Analysis and potential consequences

T0 review · 4 major / 6 minor · reviewed 2026-08-06 · deepseek-v4-flash

Pith's one-line read Four metric components point to new gravitational-wave polarizations.

desk verdict A competent textbook-style review of weak-field GR phenomena mapped to metric components, but the central claim about inactive components and new polarizations collapses under gauge invariance. read the letter →

arxiv 2506.21984 v1 pith:JH7IJ4FT submitted 2025-06-27 gr-qc

classification gr-qc MSC 83C2583C3583D05 PACS 04.30.-w04.80.Cc
keywords generalrelativityweak-fieldmetricperturbationgravitationalwavesgravitational-wavepolarizationsLense-Thirringeffectelasticanalogystraintensorlensing
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper surveys more than a century of weak-field general-relativity tests — the gravity around the Earth and Sun, gravitational lensing, the Lense–Thirring effects, and the two detected gravitational-wave events — and records which components of the metric perturbation $h_{\mu\nu}$ each phenomenon activates. It then applies the elastic analogy of spacetime, in which $h_{\mu\nu}=2\varepsilon_{\mu\nu}$ with $\varepsilon_{\mu\nu}$ the strain tensor of an equivalent four-dimensional elastic medium. Because every strain component is a real deformation, the absence of any measured phenomenon attached to $h_{0z}$, $h_{xz}$, $h_{yz}$, and $h_{zz}$ is read as a genuine gap rather than as coordinate bookkeeping. The paper concludes that these four components should correspond to unmeasured deformations of spacetime and, since deformations of a wave medium are its polarizations, to new gravitational-wave modes beyond the standard plus and cross polarizations. If the analogy is taken seriously, future interferometers should be designed to look for longitudinal and vector polarizations in the weak-field regime.

What carries the argument

The machinery is the component-wise correspondence between the weak-field metric perturbation and a four-dimensional strain tensor, $h_{\mu\nu}=2\varepsilon_{\mu\nu}$ (Eq. 16), imported from the authors' earlier work. In elasticity theory a strain tensor has no empty entries: diagonal components are elongations or shortenings and off-diagonal components are angular distortions, so once the correspondence is accepted, every entry of $h_{\mu\nu}$ must name a physical deformation of spacetime. The paper combines that correspondence with a survey of measured general-relativity effects — the Poisson equation for $h_{00}$, the lensing combination of $h_{00}$ and $h_{ii}$, the Lense–Thirring off-diagonal $h_{0i}$ terms, and the plus/cross wave components $h_{xx},h_{yy},h_{xy}$ — so that the active and inactive components can be read directly off the tensor in a single synthetic picture.

What would settle it

A decisive test is a polarization-sensitive gravitational-wave search, using space-based interferometers or pulsar timing arrays, that detects the standard plus and cross modes from a known source but finds no longitudinal or vector mode at comparable amplitude; that would show the four 'inactive' components carry no physical deformations. A simpler check: in linearized general relativity with the transverse-traceless gauge, the four components $h_{0z},h_{xz},h_{yz},h_{zz}$ are zero for a plane wave by construction, so the claim becomes testable only when a modified theory specifies the amplitude at which these modes should appear.

Watch

Extended reading notes

Core claim

The central claim, stated as a consequence of the elastic-strain reading of the weak-field metric, is that the perturbation tensor has four components with no experimentally active role in classical general relativity: $h_{0z}$, $h_{xz}$, $h_{yz}$, and $h_{zz}$ (together with their symmetric partners). The paper builds this claim by assembling the known assignments: $h_{00}$ carries Newtonian and post-Newtonian gravity, $h_{0i}$ and $h_{i0}$ carry frame dragging and the geodetic effect, and the spatial components $h_{ij}$ with $i,j\in\{x,y\}$ carry the two measured gravitational-wave polarizations $A_+$ and $A_\times$. Because the mapping $h_{\mu\nu}=2\varepsilon_{\mu\nu}$ makes every component of the metric perturbation a mechanical deformation of an elastic spacetime, the four empty slots must correspond to elongations, shortenings, or angular distortions that have not yet been measured. The authors present this as a predictive role of the elastic analogy: these components are candidates for new polarization degrees of freedom of gravitational waves, which would appear only in modified theories of gravity that go beyond classical general relativity, and which future detectors could in principle observe.

Load-bearing premise

The load-bearing premise is that the metric perturbation equals twice the strain tensor of a literal elastic spacetime, so every unused component of $h_{\mu\nu}$ must be a real unmeasured deformation; if Eq. (16) is only a formal analogy, the inference that $h_{0z},h_{xz},h_{yz},h_{zz}$ demand new physics does not follow.

Editorial extensions

If this is right

  • The four components $h_{0z}$, $h_{xz}$, $h_{yz}$, and $h_{zz}$ should be treated as physical degrees of freedom in weak-field gravity, not as gauge artifacts, if the elastic analogy holds.
  • Gravitational-wave observatories with polarization sensitivity — space-based interferometers, third-generation ground detectors, and pulsar timing arrays — should expect longitudinal or vector modes in addition to the standard two.
  • A complete weak-field theory of gravity that covers all components of $h_{\mu\nu}$ would have more than the two classical polarization states, matching predictions from modified theories with torsion.
  • The elastic analogy gives a mechanical vocabulary for future measurements: any newly seen deformation can be classified as an elongation, a shortening, or an angular distortion and assigned to its corresponding strain component.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The predictive force hinges on treating $h_{\mu\nu}=2\varepsilon_{\mu\nu}$ as a physical equivalence rather than a formal analogy; the paper itself notes that the compared components come from different coordinate frames, so rewriting all known effects in one global frame would settle whether the four slots are genuinely empty or an artifact of comparing incompatible gauges.
  • One testable extension is to compute the amplitudes of the predicted longitudinal and vector modes in a specific torsion-modified gravity model and compare them with existing upper limits from stochastic gravitational-wave background searches; any mode predicted above those bounds would already be constrained.
  • If the missing components are real, the medium's Poisson ratio of 1 implies a definite relation between the speeds of longitudinal and transverse deformations; measuring the dispersion of any future mode would test the elastic constitution of spacetime itself, not just the existence of extra polarizations.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 6 minor

Summary. The manuscript reviews weak-field general-relativity phenomena—Newtonian gravitation, gravitational lensing, gravitational waves, and Lense-Thirring/geodetic effects—and tabulates which components of the metric perturbation h_mu_nu are 'active' in each case. It then invokes the correspondence h_mu_nu = 2 epsilon_mu_nu from prior work to identify h_mu_nu with a 4D strain tensor, and concludes that the components h_0z, h_xz, h_yz and h_zz, which are absent in the standard treatments reviewed, must correspond to unmeasured deformations and potentially new gravitational-wave polarizations. The paper also introduces a vacuum elastic stress-energy tensor and proposes that LISA, Einstein Telescope, and pulsar timing could detect these new modes.

Significance. If the central claim were correct, it would imply that the two standard gravitational-wave polarizations of general relativity are incomplete and that future interferometers should observe longitudinal or vector modes. The paper provides a compact survey of known weak-field effects and is honest in Section 5.3 that the components it compares are written in different coordinate frames and cannot be directly assembled into one tensor. However, the central inference is not supported: the 'inactive' components are gauge artifacts, and Eq. (16) is assumed rather than derived. The elastic analogy therefore does not generate a testable prediction beyond restating its own assumption, and the proposed experimental searches are not tied to a concrete model or amplitude.

major comments (4)
  1. [Section 4 and Eq. (16)] The identification of h_0z, h_xz, h_yz and h_zz as 'inactive' is gauge-dependent. Under a coordinate shift x^mu -> x^mu + xi^mu, h_mu_nu transforms as h'_mu_nu = h_mu_nu - partial_mu xi_nu - partial_nu xi_mu, while curvature invariants are unchanged. In the standard transverse-traceless gauge for a wave propagating along z, these components vanish by gauge choice; in another admissible gauge they become nonzero without producing any observable deformation. Therefore the 'empty boxes' in Figure 1 are an artifact of the chosen coordinate systems, not evidence for missing degrees of freedom. Section 5.3 itself concedes that the components come from different frames and 'cannot be put directly to compare them in the same tensor'; this concession undermines the central conclusion of Section 6.
  2. [Section 5.1, Eq. (16)] The load-bearing premise h_mu_nu = 2 epsilon_mu_nu is imported from Refs. [10]-[12] without derivation, and the paper does not show that this tensor correspondence survives gauge transformations. Since the strain tensor inherits the coordinate dependence of h_mu_nu, the claimed one-to-one map between metric components and physical deformations cannot be established by comparing components written in different gauges. The 'prediction' of new polarizations in Section 6 is thus a restatement of the assumed strain-matrix structure rather than a consequence derived from general relativity or from a specified modified theory.
  3. [Section 6 and Section 7] The paper argues that the four components h_0z, h_xz, h_yz and h_zz 'cannot remain empty' and therefore must correspond to new polarizations, but this is a non sequitur. In classical GR the transverse-traceless components are the only radiative degrees of freedom; the other components are pure gauge in the usual treatment. Modified theories such as Einstein-Cartan may indeed contain extra modes, but the manuscript provides no Lagrangian, no source coupling, and no amplitude estimate, so the suggested LISA/Einstein-Telescope searches are not tied to a concrete falsifiable prediction. References [54]-[59] constrain alternative polarizations; they do not support the claim that such polarizations must exist.
  4. [Section 5.1, Eqs. (28)-(31)] Postulate n°1 introduces t_mu_nu,elastic to keep Hooke's law in vacuum, but this is an ad hoc addition rather than a derivation. No consistency condition (e.g., the Bianchi identities or a divergence-free condition) is imposed on t_mu_nu, and no relation is given that would distinguish this term from the standard gravitational-wave stress-energy pseudotensor. Since Eqs. (28)-(31) serve only to justify the analogy, they do not make the central claim robust against the gauge objection raised above.
minor comments (6)
  1. [Section 3.3] GW150914 was detected in 2015 and announced in 2016, not 'measured in 2014' as stated in the text.
  2. [Section 3.3, Eq. (13)] The argument of the cosine in Eq. (13) is written as k_sigma k_sigma; it should presumably be k_sigma x^sigma, with the index structure displayed explicitly.
  3. [Throughout] There are numerous typographical errors that hinder readability, including 'determoned', 'writren', 'Le nse-thirring', 'metrio', 'polararion', and 'sysmetrics'; these should be corrected.
  4. [Eqs. (14) and (27)] The matrices for the plus and cross polarizations are garbled by the layout; they should be presented as clean aligned 4x4 matrices so the nonzero entries are unambiguous.
  5. [Section 5.1] The labels 'Equivalence principle n°1' through 'n°6' and 'Postulate n°1' are confusing because these statements are assumptions of the analogy, not established physical principles; a clearer terminology such as 'Assumption A1' would be preferable.
  6. [Section 8] The concluding statement that Young's modulus differs in the plane and perpendicular to the plane of propagation conflicts with the earlier isotropic-elastic-medium description in Section 5.2; the constitutive model should be stated consistently.

Circularity Check

3 steps flagged · score 7.0 of 10

The predicted h0z, hxz, hyz, hzz polarizations reduce to the assumed h_mu_nu = 2 epsilon_mu_nu mapping imported from the authors' prior work, compounded by a gauge artifact.

  1. ansatz smuggled in via citation [Section 5.1, Equivalence principle n°1, Eq. (16)]
    "Equivamence principle n°1: Correspondence between the perturbation tensor of the metric and the strain tensor in the analogy of the elastic medium. This principle demonstrated in [10], [11] and [12] is as follows: 𝒉𝜇𝜈 = 2𝜀𝜇𝜈 (16)"

    Section 6 infers from this map that h0z, hxz, hyz, hzz 'do not correspond to deformations identified and measured in classical general relativity' and must be attached to complementary polarizations. That inference is obtained by assuming that every h_mu_nu component has to be a physical strain component. Once h_mu_nu = 2 epsilon_mu_nu is granted, an unfilled strain entry is 'missing' by construction; the predicted new polarizations are a restatement of the input mapping, not a consequence of GR. The mapping is imported from [10]-[12], with [11] and [12] authored by Izabel, so the central premise is a self-citation rather than an independent derivation in this paper.

  2. self definitional [Section 4, Figure 1]
    "By superimposing these different components of the tensor 𝒉𝜇𝜈 to have for the first time a global and synthetic vision, we can see that some components remain inactive 𝒉0𝑧; 𝒉𝑖𝑧; 𝒉𝑧𝑗 (with regard to the classical phenomena measured described in the previous chapter 3)."

    The list of inactive components is read off from the transverse-traceless gravitational-wave solution of Eq. (14), where h0z, hxz, hyz, hzz are zero by gauge choice. Metric perturbation components are not gauge invariant: an admissible coordinate change makes those components nonzero without changing any observable. Calling them 'inactive' and then requiring new deformations to fill them equates a coordinate artifact with a physical absence; the 'empty boxes' are defined by the chosen coordinates, not by the theory's degrees of freedom.

1 more flagged steps
  1. other [Section 5.3, 'An important point' paragraph]
    "An important point. We consider here different components of the metric perturbation, but as they are adapted to different frames of reference (the center of the Earth for the LT effect, the coordinates of the TT gauge for gravitational waves), they cannot be put directly to compare them in the same tensor. it should first have to be write in the same referential."

    This concession acknowledges that the components assembled in Figure 1 and Eq. (32) are not simultaneously defined in one coordinate system. The claimed absence of h0z, hxz, hyz, hzz therefore has no common frame in which it is meaningful. The subsequent prediction that these components correspond to new polarizations rests on a juxtaposition the authors themselves state cannot be made as written.

full rationale

The paper's useful part is a catalogue of which h_mu_nu entries are active in standard weak-field GR tests (Newtonian limit h00, spatial curvature hii, gravitational waves hij, frame-dragging h0i). That part is self-contained. The circular load-bearing step is the leap to new physics: Sections 6 and 8 conclude that h0z, hxz, hyz, hzz must correspond to unmeasured deformations and non-GR polarizations. That conclusion is not computed from Einstein's equations; it is the direct unpacking of Eq. (16), h_mu_nu = 2 epsilon_mu_nu, imported from the authors' own prior publications [10]-[12], with Izabel as author of [11] and [12]. If every h component is assumed to be a physical strain, then an empty strain box is a missing phenomenon by construction. The gauge problem makes this worse: the 'empty' components are zero only in the TT gauge used in Section 3.3, and Section 5.3 concedes the compared components come from different frames and cannot be put in the same tensor. Hence the new-polarization 'prediction' reduces to the assumed analogy plus a coordinate choice. Honest caveats are present ('These complementary polarizations have not yet been measured and therefore remain speculative at this stage'; 'if we believe in the reliability of the advanced elastic analogy'), so the circularity is partial rather than a complete disguise.

Assumptions & free parameters 2 free parameters · 5 assumptions · 3 invented entities

The paper's quantitative load is small: it adds no fitted parameters, but it imports several modeling choices from prior literature, notably the identification h_mu_nu = 2 epsilon_mu_nu, the existence of an elastic vacuum stress tensor, and a 4D strain tensor with time components. The central 'new physics' suggestion depends entirely on these imported assumptions plus the unproven inference that unfilled tensor components must correspond to real effects rather than gauge freedom.

free parameters (2)
  • Young's modulus of the spacetime medium, Y = 10^20 Pa to 10^113 Pa depending on source
    The elastic model requires a stiffness; values are quoted from refs [10]-[13],[15],[22] and are not fitted or derived here. The 'empty component' argument does not depend on the exact value.
  • Poisson's ratio of the spacetime medium, nu = 1
    Taken from refs [10],[11]-[13] based on gravitational wave deformations; it is a modeling choice for the equivalent medium.
assumptions (5)
  • ad hoc to paper h_mu_nu = 2 epsilon_mu_nu (Equivalence principle n1, Eq. 16)
    Presented as demonstrated in refs [10]-[12] and assumed throughout; no derivation is given in this paper.
  • ad hoc to paper Weak-field Einstein equations are equivalent to a generalized Hooke's law (Equivalence principle n4, Section 5.1)
    This is the conceptual bridge that lets the authors interpret h components as strains and the Einstein constant as a flexibility.
  • ad hoc to paper Postulate n1: a vacuum elastic stress-energy tensor t_mu_nu exists so that Hooke's law persists in vacuum (Eqs. 28-29)
    Introduced as a postulate to support the physical reality of spacetime deformation energy; not derived, with no observable amplitude.
  • domain assumption The 4D strain tensor epsilon_mu_nu, including time-index components, is a valid representation of spacetime deformations
    Classical elasticity strain is defined on 3D material bodies; extending it to the time coordinate is a modeling assumption of the analogy.
  • domain assumption The five selected phenomena in Section 3 are sufficient to identify all active components of h_mu_nu
    The conclusion that other components are 'inactive' assumes that no unlisted weak-field phenomenon or gauge choice activates them; the paper itself notes the frame problem in Section 5.3.
invented entities (3)
  • t_mu_nu,elastic, the elastic stress-energy of the vacuum
    purpose: To keep a Hooke's law relation in vacuum when T_mu_nu = 0 (Eqs. 28-29).
    A postulate with no quantitative prediction; it plays a supporting role and is not anchored to any external observation.
  • Additional gravitational wave polarizations associated with h0z, hxz, hyz and hzz
    purpose: To fill the supposedly empty components of the strain tensor with physical degrees of freedom and motivate searches by LISA or the Einstein Telescope.
    The authors state these polarizations have not been measured and remain speculative; no source model, amplitude, or frequency signature is provided.
  • Equivalent elastic medium of spacetime with enormous stiffness and Poisson ratio 1
    purpose: Provides the vocabulary of elongations, shears and angular distortions used to name the components of epsilon_mu_nu.
    The medium's parameters are imported from prior work by the same authors and others, not established by the experiments reviewed here.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Analogy of space-time as an elastic medium -- Study of the perturbation tensor of the metric $h_{\mu\nu}$ through the prism of the analogy of the theory of elasticity -- Analysis and potential consequences." pith.science (2026). https://pith.science/paper/JH7IJ4FT

@misc{pith2026250621984,
  author       = {Pith},
  title        = {Pith review of: Analogy of space-time as an elastic medium -- Study of the perturbation tensor of the metric $h_\mu\nu$ through the prism of the analogy of the theory of elasticity -- Analysis and potential consequences},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/JH7IJ4FT}},
  note         = {Machine review of arXiv:2506.21984}
}
abstract

A state of the art of the different deformations of space-time measured for more than a hundred years in the case of general relativity in the weak field is carried out. The phenomena of general relativity in low fields targeted are gravitational waves, Lense-thirring effects, gravitational lensing, gravitation around the earth or the sun. The overview of these different deformations highlights the different active components of the perturbation tensor of the metric $h_{\mu\nu}$. The authors show that each phenomenon corresponds to one or more very specific components of this tensor. They also show that the various components of the latter have as an image, within the framework of the elastic analogy of space-time, various coherent components of an associated strain tensor epsilon munu in terms of elongation, shortening or angular distortion of an equivalent elastic medium, modeling the behavior of space-time. By this synthetic ensemble approach and this elastic analogy, it appears clearly for the first time that some components of this tensor $h_{\mu\nu}$ remain to be determined and measured in adequacy with potential new phenomena or modified versions of general relativity in a weak field.

Figures

Figures reproduced from arXiv: 2506.21984 by the authors.

Figure 1
Figure 1. Physical phenomena associated with each component of the perturbation tensor of the metric [PITH_FULL_IMAGE:figures/full_fig_p007_1.png] view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

61 extracted references · 59 canonical work pages

  1. [10]

    T. G. Tenev, M. F. Horstemeyer, International Journal of Modern Physics D, 27, 1850083, 2018

  2. [12]

    Izabel, what is space time made of? Ed

    D. Izabel, what is space time made of? Ed. Edp sience, 2021 (XXXX) XXXXX David Izabel 17

  3. [54]

    B. P. Abbott et al. (LIGO scientific collaboration and Virgo collaboration), A Search for Tensor, Vector, and Scalar Polarizations in the Stochastic Gravitational-Wave Background, Physical Review Letters, 120, 201102, 2018

  4. [59]

    Wettea, Searches for continuous gravitational waves from neutron stars A twenty-year retrospective, Astroparticle Physics, 153, 102880, 2023 (XXXX) XXXXX David Izabel 21

    K. Wettea, Searches for continuous gravitational waves from neutron stars A twenty-year retrospective, Astroparticle Physics, 153, 102880, 2023 (XXXX) XXXXX David Izabel 21

  5. [1]

    Einstein, Die Feldgleichungen der Gravitation, Sitzungsberichte der Königlich Preußischen Akademie der Wissenschaften (Berlin), Seite, 844-847, 1915

    A. Einstein, Die Feldgleichungen der Gravitation, Sitzungsberichte der Königlich Preußischen Akademie der Wissenschaften (Berlin), Seite, 844-847, 1915

  6. [2]

    Einstein, Näherungsweise Integration der Feldgleichungen der Gravitation, Sitzung der physikalisch mathematischen Klasse,688,1916

    A. Einstein, Näherungsweise Integration der Feldgleichungen der Gravitation, Sitzung der physikalisch mathematischen Klasse,688,1916

  7. [3]

    J.Lense, H. Thirring, Über den Einflub der Eigenrotation der Zentrlkörper auf die Bewegung der Planeten und Monde nach der Einsteinschen gravitatiostheorie Physik Zeitschr XIX,156, 1918 (XXXX) XXXXX David Izabel 16

  8. [4]

    F. W. Dyson, A. S. Eddington, C. Davidson, A Determination of the Deflection of Light by the Sun’s Gravitational Field, from Observations Made at the Total Eclipse of May 29, 1919, Philosophical Transactions of the Royal Society, 220, 291-333, 1920

Show all 61 references
  1. [5]

    C. W. F. Everitt, D. B. DeBra, B. W. Parkinson, J. P. Turneaure, J. W. Conklin, M. I. Heifetz, G. M. Keiser, A. S. Silbergleit, T. Holmes, J. Kolodziejczak, M. Al-Meshari, J. C. Mester, B. Muhlfelder, V. Solomonik, K. Stahl, P. Worden, W. Bencze, S. Buchman, B. Clarke, A. Al-J...

  2. [6]

    B. P. Abbott et al., (LIGO scientific collaboration and Virgo collaboration), Observation of Gravitational Waves from a Binary Black Hole Merger GW150914, Physical Review Letter, 116, 061102, 2016

  3. [7]

    B. P. Abbott et al., (LIGO scientific collaboration and Virgo collaboration), GW170817: Observation of Gravitational Waves from a Binary Neutron Star Inspiral, Physical Review letter, 119, 161101, 2017

  4. [8]

    J.F Claeskens, These Aspect statistic du phénomène de lentille gravitationnelle dans un échantillon de quasars très lumineux Chapitre 2 Theorie du phenomene de mirage gravitationnel, Bulletin de la société royale des sciences de Liege 1998, Vol, 68 (1-4) 1999

  5. [9]

    Einstein, Uber Gravitationswellen, Sitzber Preuss Akad Wiss Berlin, 154-167, 1918

    A. Einstein, Uber Gravitationswellen, Sitzber Preuss Akad Wiss Berlin, 154-167, 1918

  6. [11]

    Izabel, Mechanical conversion of the gravitational Einstein’s constant k, Pramana Journal of Physics 94, 119, 2020

    D. Izabel, Mechanical conversion of the gravitational Einstein’s constant k, Pramana Journal of Physics 94, 119, 2020

  7. [13]

    2350091-435, 2023

    D.Izabel, Analogy of spacetime as an elastic medium—Can we establish a thermal expansion coefficient of space from the cosmological constant Λ?, International Journal of Modern Physics D, Volume 32, Issue 13, id. 2350091-435, 2023

  8. [14]

    Antoci, L

    S. Antoci, L. Mihich, A four-dimensional Hooke's law can encompass linear elasticity and inertia arXiv:gr-qc/9906094, 1999

  9. [15]

    P. A. Millette, Elastodynamics of the Spacetime Continuum, STCED, American Research Press, Rehoboth New Mexico USA, 2019

  10. [16]

    A. D. Sakharov, Vacuum quantum fluctuations in curved space and the theory of gravitation, Soviet Physics Doklady, 12, 1040-1041, 1968

  11. [17]

    J. L. Synge, A theory of elasticity in general relativity, Mathematische Zeitschrift, 72, 82-87, 1959

  12. [18]

    C. B. Rayner, Elasticity in General Relativity, Proceeding of the Royal Society A, Mathematical, Physical and Engineering Sciences, 272, 1348, 44-53, 1963

  13. [19]

    R. A. Grot, A. Eringen, Relativistic Continuum Mechanics, International Journal of Engineering Science, 4, 611- 670, 1966

  14. [20]

    Damour, La relativité générale aujourd’hui, Séminaire Poincaré, IX, 1-40, 2006

    T. Damour, La relativité générale aujourd’hui, Séminaire Poincaré, IX, 1-40, 2006

  15. [21]

    Izabel, Y Remond, M.L Ruggiero, Some geometrical aspects of gravitational waves using continuum mechanics analogy: State of the art and potential consequences, Memocs, 2024

    D. Izabel, Y Remond, M.L Ruggiero, Some geometrical aspects of gravitational waves using continuum mechanics analogy: State of the art and potential consequences, Memocs, 2024

  16. [22]

    Weiss, Ligo and the Discovery of Gravitational Waves, Nobel Lecture, December 8, 2017 by Rainer Weiss Massachusetts Institute of Technology (MIT), Cambridge, MA, USA, 2017

    R. Weiss, Ligo and the Discovery of Gravitational Waves, Nobel Lecture, December 8, 2017 by Rainer Weiss Massachusetts Institute of Technology (MIT), Cambridge, MA, USA, 2017

  17. [23]

    Elizalde, F

    E. Elizalde, F. Izaurieta, C. Riveros, G. Salgado, O. Valdivia, Gravitational Waves in ECSK theory: Robustness of mergers as standard sirens and nonvanishing torsion, arXiv:2204.00090, 2022 (XXXX) XXXXX David Izabel 18

  18. [24]

    F. L. Carneiro, S. C. Ulhoa, J. W. Maluf, J. F. da Rocha-Neto, Non-linear plane gravitational waves as space-time defects, The European Physical Journal C, 81, 67, 2021

  19. [25]

    M. L. Ruggiero, Gravitomagnetic induction in the field of a gravitational Wave, General Relativity and Gravitation, 54, 9, 97, 2022

  20. [26]

    M. L. Ruggiero, A. Tartaglia, Einstein-Cartan theory as a theory of defects in spacetime, American Journal of Physics 71, 1303-1313, 2003

  21. [27]

    Masovic, acoustic analogie in general relativity quantum field and thermo-dynamics, Technische Universität Berlin , 2022

    D. Masovic, acoustic analogie in general relativity quantum field and thermo-dynamics, Technische Universität Berlin , 2022

  22. [28]

    Kokarev, space time as strongly bent plate, Nuovo Cim.B, 114 903-921,1999

    S.S. Kokarev, space time as strongly bent plate, Nuovo Cim.B, 114 903-921,1999

  23. [29]

    Tenev, thesis An Elastic Constitutive Model of Spacetime and its Applications, 2018

    T. Tenev, thesis An Elastic Constitutive Model of Spacetime and its Applications, 2018

  24. [30]

    Perko Introducing surface tension to spacetime;J

    H.A. Perko Introducing surface tension to spacetime;J. Phys Conf Ser, 845 012003, 2017

  25. [31]

    Perko, Gravitation in the surface tension model of space-time, J Phys Conf Ser, 1239 012010, 2019

    H.A. Perko, Gravitation in the surface tension model of space-time, J Phys Conf Ser, 1239 012010, 2019

  26. [32]

    Kleinert, Emerging gravity from defects in world crystal, Braz

    H. Kleinert, Emerging gravity from defects in world crystal, Braz. J. Phys. 35 (2a,) 2005

  27. [33]

    Ciufolini Time travel, Clock Puzzles and Their Experimental Tests, The European Physical Journal Conferences, 2013

    I. Ciufolini Time travel, Clock Puzzles and Their Experimental Tests, The European Physical Journal Conferences, 2013

  28. [34]

    Johnston, Calculation on space-time curvature within the Earth and Sun, 2008

    R. Johnston, Calculation on space-time curvature within the Earth and Sun, 2008

  29. [35]

    Hencky, Über Den Spannungszustand in Kreisrunden Platten Mit Verschwindender Biegungssteigkeit, Zeitschrift fur Mathematik und Physik, Vol

    H. Hencky, Über Den Spannungszustand in Kreisrunden Platten Mit Verschwindender Biegungssteigkeit, Zeitschrift fur Mathematik und Physik, Vol. 63, 1915, pp. 311–317, 1915

  30. [36]

    Lajos Volgyesi, M Moser; The Inner Structure of the Earth, Periodica Polytechnica Chemical Engineering 26(3).1982 (XXXX) XXXXX David Izabel 19

  31. [37]

    Geoges Paturel, Cours elementaire d’astronomie et d’astrophysique, observatoire de Lyon ; 2006

  32. [38]

    Witten, A Note On Complex Spacetime Metrics, arXiv:2111.06514v2 [hep-th], 2022

    E. Witten, A Note On Complex Spacetime Metrics, arXiv:2111.06514v2 [hep-th], 2022

  33. [39]

    Roman Wiszniewski,Thesis Time, Quasi-Temporal Change and Imaginary Numbers,2006

    W. Roman Wiszniewski,Thesis Time, Quasi-Temporal Change and Imaginary Numbers,2006

  34. [40]

    H.A Perko, Dark matter and dark energy: cosmology of space time with surface tension, Conference,The 12th Biennial Conference on Classical and Quantum Relativistic Dynamics of Particles and FieldAt: Prague, Czechia, 2021

  35. [41]

    Jacob Am, Vacuum catastrophe: An elementary exposition of the cosmological constant problem, J

    Ronald J.Adler, Brendan Casey; Ovid C. Jacob Am, Vacuum catastrophe: An elementary exposition of the cosmological constant problem, J. Phys. 63, 620–626, 1995

  36. [42]

    Robertson, Optical Kerr effect in vacuum, 2019

    S. Robertson, Optical Kerr effect in vacuum, 2019

  37. [43]

    Mailliet,X

    S Robertson, A. Mailliet,X. Sarazin, F. Couchot, E. Baynard,J. Demailly, M. Pittman, A. Djannati-Ata, S. Kazamias, and M. Urban, he DeLLight experiment to observe an optically-induced change of the vacuum index, 2021

  38. [44]

    G. -L. Ingold,Casimir effect from a scattering approach» Gert -Ludwig Ingold Institut fur Physik, Universitat Augsburg, Universitatsstrae 1, D-86135 Augsburg, Germany arXiv:1404.6919v1 [quant-ph] 28 Apr 2014 p5 chapter 5, 2014

  39. [45]

    Bressi, G

    G. Bressi, G. Carugno, R. Onofrio, and G. Ruoso, Measurement of the Casimir Force between Parallel Metallic Surfaces» Volume 88, Number 4 Physical Review Letters p 3, 2002

  40. [46]

    Nawaz, Remco J

    M. Nawaz, Remco J. Wiegerink, Theo S. J. Lammerink, Miko Elwenspoek,Parallel Plate Structures For Optical Modulation and Casimir Force Measurment» Paper ID : 142, 2009

  41. [47]

    J. P. Straley (University of Kentucky),Luke S. Langsjoen (University of Virginia),Hussain Zaidi (University of Virginia, Casimir effect due to a single boundary as a manifestation of the Weyl problem» arXiv:1002.1762v1 518,2010

  42. [48]

    B.C Denardo Joshua J. Puda A. Larraza Am J Physics, 77(12) A water wave analog of the Casimir effect, 2009 (XXXX) XXXXX David Izabel 20

  43. [49]

    A.Tartaglia and N.Radicella (2010) From Elastic Continua to Space-time AIP Conf. Proc. 1241, 1156–1163 (2010)

  44. [50]

    M. R. Beau (2018) « Théorie des champs des contraintes et des déformations en relativité générale et expansion cosmologique ». - Foundations of Physics manuscript arXiv:1209.0611v2 p4 and Annales de la Fondation Louis de Broglie, Volume 40, 2015

  45. [51]

    (MICROSCOPE Collaboration) 𝑀𝐼𝐶𝑅𝑂𝑆𝐶𝑂𝑃𝐸 Mission: Final Results of the Test of the Equivalence Principle Phys

    Pierre Touboul et al. (MICROSCOPE Collaboration) 𝑀𝐼𝐶𝑅𝑂𝑆𝐶𝑂𝑃𝐸 Mission: Final Results of the Test of the Equivalence Principle Phys. Rev. Lett. 129, 121102 – Published 14 September 2022

  46. [52]

    Stefan Catheline,Victor Delattre, Gabrielle Laloy -Borgna, Fréderic Faure and Mathias Fink (2022) «Gravitational lens effect revisited through membrane waves» American journal of Physic 90, 47–50 (2022)

  47. [53]

    S. A. Balbus (2016) « Simplified derivation of the gravitational wave stress tensor from the linearized Einstein field equations»Physical Sciences 113 (42) 11662-11666 (2016)

  48. [55]

    Hou, X.L

    S. Hou, X.L. Fan, T. Zhu, Z.H. Zhu, Nontensorial gravitational wave polarizations from the tensorial degrees of freedom: 1. Linearized Lorentz-violating theory of gravity with s tensor, Physical Review D, 109, 084011, 2024

  49. [56]

    B. P. Abbott et al. (LIGO scientific collaboration and Virgo collaboration), First Search for Nontensorial Gravitational Waves from Known Pulsars, Physical Review Letters, 120, 031104, 2018

  50. [57]

    Mathur, Gravitational Wave Polarizations: A test of General Relativity using Binary Black hole mergers, Thesis, California Institute of Technology, 2020

    S. Mathur, Gravitational Wave Polarizations: A test of General Relativity using Binary Black hole mergers, Thesis, California Institute of Technology, 2020

  51. [58]

    Will, The Confrontation between General Relativity and Experiment, Living Reviews in Relativity, 17, 4, 2014

    C. Will, The Confrontation between General Relativity and Experiment, Living Reviews in Relativity, 17, 4, 2014

  52. [60]

    Kersting, Free fall in curved spacetime—how to visualise gravity in general relativity, 2019 Physics

    M. Kersting, Free fall in curved spacetime—how to visualise gravity in general relativity, 2019 Physics. Education. 54 03 5008, 2019

  53. [61]

    M. L. Ruggiero, A. Tartaglia, Gravitomagnetic effects, Nuovo Cim.B 117 (2002) 743-768, 2002

Pith tools

Reviewed August 6, 2026 · model on record in the stance chip above.