Pith. sign in

REVIEW 2 major objections 3 minor 26 references

The CEE beam monitor's chip planes must survive 10.6 kGy, 2.2e11 n_eq/cm2, and 3 kHz/cm2 hadrons over six months.

Reviewed by Pith at T0; open to challenge. T0 means a machine referee read the full paper against a public rubric. the ladder, T0–T4 →

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

FLUKA simulations predict that after six months of running, CEE beam-monitor chip planes will see up to 10.6 kGy total ionizing dose, 2.2e11 cm-2 1-MeV-neutron-equivalent fluence, and 3.0 kHz/cm2 hadron flux.

T0 review reviewed 2026-08-04 challenge →

load-bearing objection Solid, well-documented FLUKA study giving first radiation numbers for the CEE beam monitor; the headline TID is a 300-µm slab average and likely understates the chip surface dose. the 2 major comments →

arxiv 2509.11148 v1 pith:FQEWBS6Y submitted 2025-09-14 physics.ins-det

Simulation of radiation environment for the beam monitor of CEE experiment

Qian Wang , Hulin Wang , Chaosong Gao , Jun Liu , Xianglun Wei , Junshuai Liu , Zhen Wang , Ran Chen
show 7 more authors
Peng Ma Haibo Yang Chengxin Zhao Mingmei Xu Shusu Shi Xiangming Sun Feng Liu
This is my paper
classification physics.ins-det
keywords radiation calculationsbeam monitorFLUKAtotal ionizing dosedisplacement damagesingle-event effectsheavy-ion beamsGEM detector
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper aims to establish the radiation environment the CEE experiment's beam monitor will face, using FLUKA simulations of 500 MeV/u uranium and 1 GeV/u carbon beams interacting with the monitor's gas, GEM layers, and chip planes. It reports peak values for the chip planes over six months of running: about 10.6 kGy total ionizing dose, 2.2e11 cm^-2 1 MeV neutron equivalent fluence, and 3.0 kHz/cm^2 hadron flux above 20 MeV, all for the uranium beam. These numbers set the survival specifications for the Topmetal-CEE sensor chips and readout electronics. The paper also shows that the radiation field is dominated by low-energy electrons produced in the gas and field-cage windows, that GEM layers and thinner windows reduce the dose, and that lead shielding does not.

Core claim

The central claim is that the benchmark U-ion beam (500 MeV/u, 1 MHz, 2.35 mm FWHM) deposits, over six months of CEE running, a maximum total ionizing dose of 10.6 kGy, a maximum 1 MeV neutron equivalent fluence of 2.2e11 cm^-2, and a maximum hadron (>20 MeV) fluence rate of 3.0 kHz/cm^2 on the beam-monitor chip planes in the second field cage. The same quantities for the C-ion beam are about three orders of magnitude smaller for TID and NIEL, and about one order smaller for hadron flux. Electrons account for the dominant share of TID and about 80% of NIEL, while neutrons and protons dominate the hadron flux. Alternative geometries show that two GEM layers cut TID by about 55% and NIEL by ab

What carries the argument

The analysis is carried by a FLUKA Monte Carlo model of the beam monitor: a detailed geometry of the aluminum gas chamber, two field cages with PCB and Kapton/copper windows, up to two GEM layers (50 um Kapton with 5 um copper on both sides), and 300 um silicon chip planes above a 1.6 mm PCB, with Ar(70%)+CO2(30%) at atmospheric pressure. The simulation uses PRECISION defaults plus ion electromagnetic dissociation, coalescence, and heavy-fragment evaporation; electron/positron thresholds at 10 keV correspond to 0.21 cm range in the gas. This model is used to score TID, 1 MeV neutron equivalent fluence, hadron flux, thermal neutron flux, and nuclear fragment flux on the chip planes.

Load-bearing premise

The simulated geometry is taken to represent the real monitor: front-end cards, support structures, and cables are absent, the GEM and chip layers are ideal uniform slabs, and the beam is a fixed 2-D Gaussian profile at 1 MHz, so the reported peak doses and fluences could shift if the real beam halo, materials, or beamline layout differ from the model.

What would settle it

Measure the absorbed dose and particle fluxes at the chip-plane positions with passive dosimeters (e.g., TLDs and activation foils) during a real 500 MeV/u U-ion run of known integrated beam time; if the measured peak TID deviates from 10.6 kGy by more than the ~20% level expected from geometry uncertainties, the simulated radiation environment is not representative.

Watch this falsifier. Get emailed when new claim-graph text bears on it.

If this is right

  • The peak radiation numbers (10.6 kGy, 2.2e11 n_eq/cm^2, 3.0 kHz/cm^2 HEH) are the engineering limits the Topmetal-CEE chip and its readout electronics must be designed and tested against.
  • Since low-energy electrons dominate the dose and displacement damage, thinning the field-cage entrance/exit windows (from 25.4 um Kapton/copper to 2 um Mylar/aluminum) lowers TID and NIEL to roughly 20–30% of the nominal values on the chip planes.
  • Inserting two GEM layers reduces TID by about 55% and NIEL by about 35% without affecting high-energy hadron flux, because the GEM layers stop the soft electron component.
  • Lead shielding plates of 1 cm thickness placed inside the gas chamber do not reduce TID, NIEL, or HEH fluxes; the radiation comes from particles generated inside the field cages and the gas, not from the direct beam.
  • Moving the beam exit window from 2.8 cm to 20 cm upstream leaves TID and NIEL essentially unchanged but raises the HEH flux on the first cage by about a factor of two.

Where Pith is reading between the lines

These are editorial extensions of the paper, not claims the author makes directly.

  • Because the TID/NIEL are driven by low-energy secondaries produced in any material near the beam line, real front-end cards, cables, and support structures omitted from the model could raise the peak chip-plane dose beyond the simulated 10.6 kGy; a sensitivity study with a few thin plates mimicking those structures would bracket the effect.
  • The simulated dominance of electrons and the 70 keV electron peak at the chip surface imply that a very thin low-Z absorber (a foil or an extra GEM-like layer) is a cheap, effective dose-reduction measure, potentially more practical than lead shielding.
  • The near-independence of TID from beam width (1–6 mm FWHM) suggests the hottest region is set by the geometry of the field cages and gas volume rather than by the direct beam core, so halo uncertainties are unlikely to change the peak TID much.
  • The thermal neutron fluence for U-ion is below 0.26 cm^-2 s^-1; if the 10B content of chip packaging is low, SEE from thermal neutron capture should be negligible, but that conclusion depends on the actual chip boron content not modeled here.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

2 major / 3 minor

Summary. This manuscript reports FLUKA Monte Carlo simulations of the radiation environment of the CEE beam monitor (BM). For the benchmark configuration — 500 MeV/u U and 1 GeV/u C beams at 1 MHz, a 2.35 mm FWHM Gaussian beam profile, and two GEM layers — the authors quote maximum chip-plane values over six months of operation: about 10.6 kGy total ionizing dose (TID), 2.2×10^11 cm^-2 1 MeV neutron equivalent fluence, and 3.0 kHz/cm^2 hadron flux above 20 MeV. The paper also gives thermal neutron fluxes, nuclear fragment fluences, and a sensitivity study of shielding, thinner field-cage windows, GEM layer count, beam width, and BM position. The intended use is to provide engineering radiation limits for the Topmetal-CEE chip and its readout electronics.

Significance. If the reported numbers are correct, they are the primary radiation-design inputs for the CEE beam monitor and are directly relevant to the chip qualification process. The simulation setup is documented in enough detail to be reproduced, and the paper contains a useful internal consistency check: the quoted peak dose rate of 540 µGy/s over six months corresponds to the reported 8.4 kGy peak. The alternative-geometry studies, especially the 'less material' field-cage window, provide a valuable sensitivity estimate. However, the central TID result is weakened by an unaddressed scoring-depth issue, and the quoted statistical errors are far smaller than the unquantified systematic uncertainties from geometry simplifications. These issues must be resolved before the numbers can be used for radiation-hardness decisions.

major comments (2)
  1. [Section 3.1, Section 2.1, Table 1] The reported TID is scored as the energy deposited per unit mass over the whole 300 µm thick silicon slab that represents the chip plane. The electron spectrum at the chip surface peaks at about 70 keV (Fig. 12, Section 3.6.6); the range of such electrons in silicon is only a few tens of micrometers, so the energy deposition is strongly concentrated near the surface. The sensitive transistor oxides sit in the top few micrometers, as the authors themselves recognize when scoring nuclear fragments at 10 µm below the chip top surface (Section 3.5). Averaging over 300 µm therefore dilutes the dose that the electronics actually receive. The paper should report the TID scored in a thin surface layer (e.g., 1–10 µm) or provide a depth profile; without this, the quoted maximum of 10.6 kGy is not yet the relevant engineering number for the chip oxide dose.
  2. [Section 2.2, Tables 1–3 and 6] Only statistical Monte Carlo errors are quoted, and these are at the sub-percent level. Systematic uncertainties from the documented geometry simplifications — omitted front-end cards, supports, and cables; idealized field-cage windows; a fixed Gaussian beam profile at a single energy and rate — are not evaluated. This is load-bearing because Section 3.1 states that electrons produced in the gas and in the field-cage windows contribute more than 99.5% of the TID, so the exact material budget of those windows is a controlling parameter. The authors' own 'less material' study (Section 3.6.2, Table 6) changes the first-cage TID by about a factor of 3.5. The reported peak values should therefore carry a systematic uncertainty or a bound derived from the sensitivity scans; the current presentation is not sufficient for use in a radiation-qualification context.
minor comments (3)
  1. [Section 3.6.6, Table 6] The statement that 'The shielding layers have no visible impact' is not supported by the quoted errors. For example, the first-cage TID changes from 5.699±0.002 kGy to 5.732±0.002 kGy, a shift many times the statistical error. The authors should rephrase this as 'no practically significant impact' and specify what change is considered significant relative to the radiation tolerance margins.
  2. [Section 3.4] The 95% confidence upper limit for the U-ion thermal neutron flux is presented without explaining the statistical method. The phrase 'assuming a track length equal to the thickness of chip plane' is unclear; please state explicitly how the Poisson zero-count upper limit is converted to a flux.
  3. [Section 3.1] The sentence giving the peak dose rates for the two field cages is easy to misread. Please make explicit which beam species corresponds to the un-bracketed and bracketed numbers for each cage, e.g., 'U-ion (C-ion): 540 (1.2) µGy/s for the first cage and 680 (1.4) µGy/s for the second cage.'

Circularity Check

0 steps flagged

No significant circularity: the radiation quantities are FLUKA simulation outputs from stated geometry and beam inputs; self-citations supply input parameters, not the predicted results.

full rationale

The paper's central claims are Monte Carlo simulation results for TID, 1 MeV neutron equivalent fluence, high-energy hadron flux, thermal neutron flux, and nuclear fragment flux. These are obtained by running FLUKA with an explicitly described geometry, material composition, beam profile, particle rate, and physics settings. No parameter is fitted to a subset of measured data and then renamed a prediction, and no output quantity is defined in terms of another output quantity. The self-citations to refs. [10,11,16,17] are used as sources for the BM prototype design, the Topmetal-CEE chip, and readout electronics; these are input specifications for the simulation, not the target results, so they do not make the derivation circular. The paper also includes alternative geometry and beam studies, which further demonstrates that the outputs respond to inputs in a non-tautological way. The reader-raised concern about scoring TID over a 300 micron silicon slab while the relevant electronics lie in the top few microns is a dosimetry-definition or correctness issue, not a circularity: the reported dose is what the simulation computes under that scoring choice, and it is not equivalent to the assumed inputs by construction. Thus the analysis is self-contained with respect to the claims it makes, and no circular step is present.

Axiom & Free-Parameter Ledger

0 free parameters · 6 axioms · 0 invented entities

The central numbers rest on assumptions imported from FLUKA, from the experiment's beam plan, and from the group's own detector design. No free parameters are fitted to data; the beam scenario and geometry details are assumed inputs. The main exposure is that these inputs are not independently validated or swept for systematics in the paper, and the omitted materials and beam-halo assumptions affect exactly the quantities being reported.

axioms (6)
  • domain assumption FLUKA PRECISION defaults plus the ion electromagnetic dissociation, coalescence, and evaporation cards correctly model electron, hadron, neutron, and heavy-ion transport in this regime.
    Invoked in Section 2.2; no independent validation of these model choices is given in the paper.
  • domain assumption Benchmark beam scenario: 500 MeV/u U and 1 GeV/u C ions, 1 MHz rate, 2D Gaussian profile with FWHM 2.35 mm, and six months total beam time over three years.
    Defined in Section 2.2; these are assumed inputs, not measured values, and they set all absolute dose and fluence numbers.
  • domain assumption Simplified geometry is representative: front-end cards, support structures, and cables are omitted; GEM layers are uniform 50 um Kapton with 5 um copper; chips are 300 um silicon.
    Section 2.1 states these simplifications; no sensitivity study is performed for the omitted materials.
  • domain assumption Transport and production thresholds (10 keV for e-/e+, 1 keV for photons, thermal energy for neutrons, 10 keV for delta rays) do not materially bias TID or NIEL estimates.
    Section 2.2 sets these thresholds; no threshold-variation study is presented.
  • domain assumption SEE-relevant cut definitions from the literature: hadrons above 20 MeV, thermal neutrons below 0.5 eV, and fragments with LET above 0.25 MeV cm2/mg.
    Used throughout Section 3, based on refs [22-26]; these are imported domain conventions, not derived in the paper.
  • domain assumption Monte Carlo statistics of 3e5 U-ion and 9e7 C-ion events are sufficient for the reported rates, with zero-count cases treated as 95% confidence upper limits.
    Section 2.2 and 3.4; the U-ion run is short relative to the 1 MHz rate and yields only upper limits for thermal neutrons.

reviewed 2026-08-04 · how reviews work

0 comments
Cite this review

Pith. "Pith review of Simulation of radiation environment for the beam monitor of CEE experiment." pith.science (2026). https://pith.science/paper/FQEWBS6Y

@misc{pith2026250911148,
  author       = {Pith},
  title        = {Pith review of: Simulation of radiation environment for the beam monitor of CEE experiment},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/FQEWBS6Y}},
  note         = {Machine review of arXiv:2509.11148}
}
Share X Bluesky LinkedIn Reddit HN
read the original abstract

The cooling storage ring external-target experiment is a large-scale nuclear physics experiment, which aims to study the physics of heavy-ion collisions at low temperatures and high baryon densities. A beam monitor (BM) is placed in the beam line to monitor the beam status and to improve the reconstruction resolution of the primary vertices. The radiation dose and particle fluence stemming from the beam interactions with gases and detector materials affect the performance of the sensors and electronics of BM. This paper uses FLUKA Monte Carlo code to simulate the radiation environment of BM detector. Radiation quantities including the total ionizing dose, 1 MeV neutron equivalent fluence, high-energy hadron flux, thermal neutron flux, and nuclear fragment flux are presented. Results of alternative simulation setups, including adding shielding layers inside the BM, are also investigated.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Reference graph

Works this paper leans on

26 extracted references

  1. [1]

    Y. Yuan, J. Yang, J. Xia, P. Yuan, W. Qiao, D. Gao et al.,Status of the hirfl–csr complex,Nuclear Instruments and Methods in Physics Research Section B: Beam Interactions with Materials and Atoms317(2013) 214

    2013

  2. [2]

    L. Lü, H. Yi, Z. Xiao, M. Shao, S. Zhang, G. Xiao et al.,Conceptual design of the hirfl-csr external-target experiment,Science China Physics, Mechanics & Astronomy60(2016) 012021

    2016

  3. [3]

    X.Luo,S.Shi,N.XuandY.Zhang,Astudyofthepropertiesoftheqcdphasediagraminhigh-energy nuclear collisions,Particles3(2020) 278

    2020

  4. [4]

    J. Yuan, Y. Qian, H. Zhao, Q. She, C. Wang, Z. Sun et al.,Development of multichannel readout electronics prototype system for tpc detector of csr external-target experiment,Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment1052(2023) 168281

    2023

  5. [5]

    L.-M. Lyu, H. Yi, L.-M. Duan, Z. Zhang and Z.-G. Xiao,Simulation and prototype testing of multi-wire drift chamber arrays for the cee,Nuclear Science and Techniques31(2020) 11

    2020

  6. [6]

    D. Hu, X. Wang, M. Shao, Y. Sun, C. Li, H. Chen et al.,Beam test study of the mrpc-based t0 detector for the cee,Journal of Instrumentation14(2019) C09030

    2019

  7. [7]

    X. Wang, D. Hu, M. Shao, L. Zhao, Y. Sun, J. Lu et al.,Cee inner tof prototype design and preliminary test results,Journal of Instrumentation17(2022) P09023

    2022

  8. [8]

    B. Wang, H. Xu, K. Sun, D. Liu, D. Han, Y. Wang et al.,Beam test result of the sealed mrpc prototype for cee-etof,Journal of Instrumentation18(2023) C11001

    2023

  9. [9]

    S. Zhu, H. Yang, H. Pei, C. Zhao, X. Li and G. Huang,Prototype design of readout electronics for zero degree calorimeter in the hirfl-csr external-target experiment,Journal of Instrumentation16 (2021) P08014

    2021

  10. [10]

    H.-L. Wang, Z. Wang, C.-S. Gao, J.-W. Liao, X.-M. Sun, H.-B. Yang et al.,Design and tests of the prototype beam monitor of the csr external target experiment,Nuclear Science and Techniques33 (2022) 36

    2022

  11. [11]

    H. Wang, X. Wei, C. Gao, J. Liu, J. Liu, Z. Wang et al.,Design and performance of the prototype gaseous beam monitor with gem and pixel sensors for the csr external-target experiment,Journal of Instrumentation20(2025) C07047

    2025

  12. [12]

    Ahdida, D

    C. Ahdida, D. Bozzato, D. Calzolari, F. Cerutti, N. Charitonidis, A. Cimmino et al.,New capabilities of the fluka multi-purpose code,Frontiers in PhysicsVolume 9 - 2021(2022)

    2021

  13. [13]

    Battistoni, T

    G. Battistoni, T. Boehlen, F. Cerutti, P.W. Chin, L.S. Esposito, A. Fassò et al.,Overview of the fluka code,Annals of Nuclear Energy82(2015) 10

    2015

  14. [14]

    Technol.10(2024) 20

    Hugo, Gabrielle, Ahdida, Claudia, Bozzato, Davide, Calzolari, Daniele, Cerutti, Francesco, Ciccotelli, Alessia et al.,Latest fluka developments,EPJ Nuclear Sci. Technol.10(2024) 20. – 13 –

    2024

  15. [15]

    Donadon, André, Hugo, Gabrielle, Theis, Christian and Vlachoudis, Vasilis,Flair3 – recasting simulation experiences with the advanced interface for fluka and other monte carlo codes,EPJ Web Conf.302(2024) 11005

    2024

  16. [16]

    J.Liu,C.Gao,H.Wang,Z.Wang,B.You,X.Sunetal.,Designandpreliminarycharacterizationofa novel silicon charge sensor for the gaseous beam monitor at the csr external-target experiment, Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment1047(2023) 167786

    2023

  17. [17]

    Liu, C.-S

    J. Liu, C.-S. Gao, H.-L. Wang, Z. Wang, X.-M. Sun, R. Chen et al.,Readout electronics for beam monitor in the external-target experiment of csr,Nuclear Science and Techniques36(2025) 87

    2025

  18. [18]

    Oldham and F

    T. Oldham and F. McLean,Total ionizing dose effects in mos oxides and devices,IEEE Transactions on Nuclear Science50(2003) 483

    2003

  19. [19]

    Cassani, L

    M. Cassani, L. Sambuco Salomone, S. Carbonetto, A. Faigón, E. Redin and M. Garcia-Inza, Experimental characterization and numerical modeling of total ionizing dose effects on field oxide mos dosimeters,Radiation Physics and Chemistry182(2021) 109338

    2021

  20. [20]

    Namenson, E.A

    A.I. Namenson, E.A. Wolicki and G.C. Messenger,Average silicon neutron displacement kerma factor at 1 mev,IEEE Transactions on Nuclear Science29(1982) 1018

    1982

  21. [21]

    Moll,Displacement damage in silicon detectors for high energy physics,IEEE Transactions on Nuclear Science65(2018) 1561

    M. Moll,Displacement damage in silicon detectors for high energy physics,IEEE Transactions on Nuclear Science65(2018) 1561

    2018

  22. [22]

    Lerner, P

    G. Lerner, P. Pelissou, Y.Q. Aguiar, M.S. Barbero, M. Cecchetto, K. Biłko et al.,Analysis of the radiation field generated by 200-mev electrons on a target at the clear accelerator at cern,IEEE Transactions on Nuclear Science70(2023) 1572

    2023

  23. [23]

    Huhtinen and F

    M. Huhtinen and F. Faccio,Computational method to estimate single event upset rates in an accelerator environment,Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment450(2000) 155

    2000

  24. [24]

    Cecchetto, R

    M. Cecchetto, R. García Alía, F. Wrobel, M. Tali, O. Stein, G. Lerner et al.,Thermal neutron-induced seus in the lhc accelerator environment,IEEE Transactions on Nuclear Science67(2020) 1412

    2020

  25. [25]

    Sacristán Barbero, I

    M. Sacristán Barbero, I. Slipukhin, M. Cecchetto, D. Prelipcean, Y. Aguiar, K. Bilko et al., Characterization of fragmented ultrahigh-energy heavy ion beam and its effects on electronics single-event effect testing,IEEE Transactions on Nuclear Science71(2024) 1557

    2024

  26. [26]

    Wyrwoll, R.G

    V. Wyrwoll, R.G. Alía, K. Røed, P. Fernández-Martínez, M. Kastriotou, M. Cecchetto et al.,Heavy ion nuclear reaction impact on see testing: From standard to ultra-high energies,IEEE Transactions on Nuclear Science67(2020) 1590. – 14 –

    2020

This paper was first reviewed by deepseek-v4-flash on August 4, 2026.