Pith. sign in

REVIEW 2 major objections 2 minor 32 references

Modular Variables and the Limits of Phase Detectability in Open Quantum Systems

T0 review · 2 major / 2 minor · reviewed 2026-05-22 · grok-4.3

Pith's one-line read Gravitational acceleration produces a time-varying modular signal sensitive to relative phase in separated wave packets.

desk verdict Modular variables track gravitational phase in non-overlapping packets via Bohmian paths where densities fail, but the locality may still rely on global wavefunction access. read the letter →

arxiv 2605.22293 v1 pith:MXVYC5DN submitted 2026-05-21 quant-ph

classification quant-ph
keywords modularvariablesquantumnonlocalitygravitationalfieldopensystemsBohmianmechanicsphasesensitivitywavepacketsuperposition
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper investigates how modular variables can access relative phase information in spatially separated quantum wave packets that conventional local measurements cannot. Under a uniform gravitational field, the time evolution of Hermitian modular operators generates a signal that stays sensitive to this phase for both unitary and open-system dynamics. Using the Bohmian interpretation, local expectations along trajectories show that gravity induces phase-dependent variations in the modular observable, while probability density and current become phase-insensitive without overlap. Environment correlations in multi-particle cases affect local signals but limit phase transfer to distant particles, and standard coherence measures miss this information.

What carries the argument

The modular observable, a Hermitian operator built from modular variables that captures nonlocal relative phase information between well-separated wave-packet components.

What would settle it

A direct computation or measurement demonstrating that the modular expectation value loses its phase sensitivity under gravity when spatial overlap is negligible, contrary to the predicted time-varying signal.

Watch

Extended reading notes

Core claim

The central discovery is that gravitational acceleration induces a time-varying modular signal, the expectation value of the modular observable, that remains sensitive to the relative phase between the separated wave packets. In contrast, standard local quantities such as the probability density and probability current become insensitive to the relative phase in the regime of negligible spatial overlap. This is shown for Gaussian wave-packet superpositions evolving under the Schrödinger equation and the Caldeira-Leggett master equation, with local values computed via Bohmian trajectories. For particles coupled to a shared environment, environment-induced correlations modify the local modular

Load-bearing premise

That local expectation values of modular operators can be meaningfully computed along individual Bohmian trajectories and that these values continue to encode the relative phase information when the wave packets have negligible spatial overlap.

Editorial extensions

If this is right

  • Gravity induces a detectable time-varying variation in modular expectations that tracks relative phase.
  • Probability density and current lose phase sensitivity when wave packets have negligible spatial overlap.
  • Shared environments create correlations modifying one particle's modular signal without significant phase transfer to distant particles.
  • Conventional coherence and entanglement measures fail to capture relative phase in the non-overlapping regime.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • This approach could enable probing of gravitational effects on quantum superpositions using nonlocal observables in separated systems.
  • It suggests that phase information may persist in modular signals under decoherence longer than in standard observables.
  • Similar analyses in other external fields could test the generality of phase preservation in modular variables.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

2 major / 2 minor

Summary. The paper claims that modular variables can detect the relative phase between spatially separated Gaussian wave packets in a gravitational field even when their spatial overlap is negligible. Using the Bohmian interpretation, local expectation values of Hermitian modular operators are computed along particle trajectories for both closed (Schrödinger) and open (Caldeira-Leggett) dynamics. These modular signals show time-varying behavior induced by gravity that retains phase sensitivity, in contrast to the probability density and current. For two particles in a shared environment, environment-induced correlations affect the modular signal but phase sensitivity transfer is negligible.

Significance. If the central claim holds, this work illustrates how modular observables combined with Bohmian trajectories can access phase information that is inaccessible to standard local measurements in the non-overlapping regime. This has potential significance for testing quantum effects in gravity and understanding decoherence in open systems. The explicit use of Gaussian packets and master equation provides a concrete, calculable example.

major comments (2)
  1. [Bohmian trajectories section (around the sentence beginning 'Adopting the Bohmian interpretation...')] The key assumption that local expectation values of modular operators along Bohmian trajectories encode the relative phase when spatial overlap is negligible requires clarification. Specifically, since the Bohmian velocity field depends on the global ψ, it is not clear if the modular expectation is computed in a way that uses only local information or retains access to the full wave function. This is load-bearing for the claim that it provides a genuinely local yet phase-sensitive signal.
  2. [Two-particle open system analysis] The statement that 'the transfer of phase sensitivity via environment-generated entanglement to the modular signal of the distant particle remains negligible' should be supported by explicit parameter values or plots showing the dependence on coupling strength or temperature to make the conclusion robust.
minor comments (2)
  1. Check for consistency in notation for the modular operators throughout the text.
  2. The abstract could benefit from a brief mention of the specific modular operators considered, e.g., periodic functions of position or momentum.

Simulated Author's Rebuttal

2 responses · 0 unresolved

We thank the referee for their careful reading and constructive comments on our manuscript. We address each major comment below, providing clarification where needed and indicating the revisions we will implement.

read point-by-point responses
  1. Referee: [Bohmian trajectories section (around the sentence beginning 'Adopting the Bohmian interpretation...')] The key assumption that local expectation values of modular operators along Bohmian trajectories encode the relative phase when spatial overlap is negligible requires clarification. Specifically, since the Bohmian velocity field depends on the global ψ, it is not clear if the modular expectation is computed in a way that uses only local information or retains access to the full wave function. This is load-bearing for the claim that it provides a genuinely local yet phase-sensitive signal.

    Authors: We thank the referee for highlighting this important point regarding the locality of the computation. Although the Bohmian velocity field is determined by the global wave function, the local expectation value of the modular operator along each trajectory is evaluated by integrating the operator against the local probability density and phase gradient in the immediate vicinity of the particle position. This uses only information accessible locally at that point on the trajectory, while the phase sensitivity to the distant packet arises from the structure of the superposition encoded in the wave function. We will revise the Bohmian trajectories section to include an explicit derivation of this local evaluation and a discussion of how it differs from standard local observables, thereby clarifying that the signal is genuinely local in its measurement while retaining phase information. revision: yes

  2. Referee: [Two-particle open system analysis] The statement that 'the transfer of phase sensitivity via environment-generated entanglement to the modular signal of the distant particle remains negligible' should be supported by explicit parameter values or plots showing the dependence on coupling strength or temperature to make the conclusion robust.

    Authors: We agree that providing explicit support will make this conclusion more robust. In the revised manuscript, we will include additional plots of the modular signal for the distant particle as a function of the system-environment coupling strength and temperature. We will also report the specific numerical parameter values employed in our Caldeira-Leggett simulations to demonstrate that the phase sensitivity transfer remains negligible across the relevant range of these parameters. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity in derivation of modular phase signals

full rationale

The paper solves the time-dependent Schrödinger equation and the high-temperature Caldeira-Leggett master equation for Gaussian wave-packet superpositions in a uniform gravitational field, then evaluates Hermitian modular operators along Bohmian trajectories generated by the standard guidance equation v = (ħ/m) Im(∇ψ/ψ). The reported time-varying modular expectation value emerges directly from this computation and retains sensitivity to the relative phase precisely because the pilot-wave field encodes global phase information even at negligible overlap; this is a standard consequence of the chosen interpretation rather than a definitional equivalence or fitted input. No self-citation chains, uniqueness theorems, or ansatzes are invoked to force the central result, and the contrast with probability density and current follows immediately from the same equations without additional assumptions that presuppose the outcome.

Assumptions & free parameters 0 free parameters · 2 assumptions · 0 invented entities

The work rests on two established domain assumptions rather than new free parameters or invented entities: the validity of the Bohmian interpretation for local modular expectations and the applicability of the high-temperature Caldeira-Leggett master equation.

assumptions (2)
  • domain assumption Bohmian interpretation of quantum mechanics permits computation of local expectation values of modular operators along individual particle trajectories that encode relative phase even without spatial overlap
    Explicitly adopted to obtain local modular signals in the non-overlapping regime.
  • domain assumption High-temperature limit of the Caldeira-Leggett master equation adequately models environment-induced decoherence for the open-system dynamics considered
    Used to describe the shared-environment case for two particles.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Modular Variables and the Limits of Phase Detectability in Open Quantum Systems." pith.science (2026). https://pith.science/paper/MXVYC5DN

@misc{pith2026260522293,
  author       = {Pith},
  title        = {Pith review of: Modular Variables and the Limits of Phase Detectability in Open Quantum Systems},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/MXVYC5DN}},
  note         = {Machine review of arXiv:2605.22293}
}
read the original abstract

Modular variables serve as a striking example of quantum nonlocality, particularly in superpositions of wave packets that are spatially well separated, where the relative phase between components cannot be accessed through conventional local measurements. In this work, we explore the time evolution of Hermitian modular operators for Gaussian wave-packet superpositions under the influence of a uniform gravitational field. We consider both unitary dynamics governed by the Schr\"odinger equation and open-system dynamics described by the Caldeira-Leggett master equation in the high-temperature limit. Adopting the Bohmian interpretation of quantum mechanics, we compute local expectation values of these modular operators along individual particle trajectories. Our analysis shows that gravitational acceleration induces a time-varying modular signal, the expectation value of the modular observable, that remains sensitive to the relative phase between the separated wave packets. In contrast, standard local quantities such as the probability density and probability current, while modified by gravity, become insensitive to the relative phase in the regime of negligible spatial overlap. For a pair of particles coupled to a shared environment, we find that environment-induced correlations can modify the local modular expectation value observed for one particle, yielding a clear signature of environmental influence. However, the transfer of phase sensitivity via environment-generated entanglement to the modular signal of the distant particle remains negligible within the regime considered. We further demonstrate that conventional measures of coherence and entanglement do not capture the relative phase information in this non-overlapping regime.

Figures

Figures reproduced from arXiv: 2605.22293 by the authors.

Figure 1
Figure 1. FIG. 1: Density plots of the probability density for the Schr¨odinger dynamics (left) and the CL dynamics (right) at [PITH_FULL_IMAGE:figures/full_fig_p013_1.png] view at source ↗
Figure 2
Figure 2. FIG. 2: Local expectation value of the modular variable along Bohmian trajectories for a relative phase [PITH_FULL_IMAGE:figures/full_fig_p013_2.png] view at source ↗
Figure 3
Figure 3. FIG. 3: Local expectation value of modular variable along the Bohmian trajectory with initial position [PITH_FULL_IMAGE:figures/full_fig_p014_3.png] view at source ↗
Figures from the paper (1 more)
Figure 4
Figure 4. Figure 4: FIG. 4: Expectation value of the modular variable of the first particle [Eq. (59)] for relative phases [PITH_FULL_IMAGE:figures/full_fig_p015_4.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

32 extracted references · 32 canonical work pages

  1. [1]

    Aharonov, Y., Pendleton, H., Petersen, A. (1969). Modular variables in quantum theory. International Journal of Theo- retical Physics, 2, 213-230

  2. [2]

    Aharonov, Y., and Rohrlich, D. (2008). Quantum paradoxes: quantum theory for the perplexed. John Wiley and Sons

  3. [3]

    Tollaksen, J., Aharonov, Y., Casher, A., Kaufherr, T., and Nussinov, S. (2010). Quantum interference experiments, modular variables and weak measurements. New Journal of Physics, 12(1), 013023

  4. [4]

    (2007, May)

    Tollaksen, J. (2007, May). Novel relationships between superoscillations, weak values, and modular variables. In Journal of Physics: Conference Series (Vol. 70, No. 1, p. 012016). IOP Publishing

  5. [5]

    C., Aharonov, Y., Tollaksen, J., Berrigan, E

    Lobo, A. C., Aharonov, Y., Tollaksen, J., Berrigan, E. M., de Assis Ribeiro, C. (2014). Weak values and modular variables from a quantum phase-space perspective. Quantum Studies: Mathematics and Foundations, 1(1), 97-132

  6. [6]

    Carvalho, M. A. D., Ferraz, J., Borges, G. F., de Assis, P. L., P´ adua, S., Walborn, S. P. (2012). Experimental observation of quantum correlations in modular variables. Physical Review A-Atomic, Molecular, and Optical Physics, 86(3), 032332

  7. [7]

    R., Far´ ıas, O

    Barros, M. R., Far´ ıas, O. J., Keller, A., Coudreau, T., Milman, P., Walborn, S. P. (2015). Detecting multipartite spatial entanglement with modular variables. Physical Review A, 92(2), 022308

  8. [8]

    P., Coudreau, T., Milman, P

    Ketterer, A., Keller, A., Walborn, S. P., Coudreau, T., Milman, P. (2016). Quantum information processing in phase space: A modular variables approach. Physical Review A, 94(2), 022325

Show all 32 references
  1. [9]

    O., Leggett, A

    Caldeira, A. O., Leggett, A. J. . Path integral approach to quantum Brownian motion. Physica,121A(3), 587-616 (1983)

  2. [10]

    O.: An introduction to macroscopic quantum phenomena and quantum dissipation

    Caldeira, A. O.: An introduction to macroscopic quantum phenomena and quantum dissipation. Cambridge University Press (2014)

  3. [11]

    V., Miret-Art´ es, S.: On some unexplored decoherence aspects in the Caldeira-Leggett formalism: arrival time distributions, identical particles and diffraction in time

    Mousavi, S. V., Miret-Art´ es, S.: On some unexplored decoherence aspects in the Caldeira-Leggett formalism: arrival time distributions, identical particles and diffraction in time. Euro. Phys. J. Plus,137(1), 1-14 (2022)

  4. [12]

    G.: Quantum phase communication channels in the presence of static and dynamical phase diffusion

    Trapani, J., Teklu, B., Olivares, S., Paris, M. G.: Quantum phase communication channels in the presence of static and dynamical phase diffusion. Phys. Rev. A., 92, 012317 (2015)

  5. [13]

    G.: Noisy quantum phase communication channels

    Teklu, B., Trapani, J., Olivares, S., Paris, M. G.: Noisy quantum phase communication channels. Phys. Scr., 90(7), 074027 (2015)

  6. [14]

    Bohm, D.: A suggested interpretation of the quantum theory in terms of” hidden” variables. I. Phys. Rev.,85(2), 166 (1952)

  7. [15]

    , Goldstein S., Zanghi N.: Quantum chaos, classical randomness, and Bohmian mechanics

    D¨ urr D. , Goldstein S., Zanghi N.: Quantum chaos, classical randomness, and Bohmian mechanics. J. Stat. Phys.68259 (1992)

  8. [16]

    Holland. P. R. The Quantum Theory of Motion. Cambridge University Press (1993)

  9. [17]

    Nature, 643(8070), 67-72 (2025)

    Sharoglazova, V., Puplauskis, M., Mattschas, C., Toebes, C., and Klaers, J.: Energy–speed relationship of quantum particles challenges Bohmian mechanics. Nature, 643(8070), 67-72 (2025)

  10. [18]

    arXiv preprint arXiv:2507.08049 (2025)

    Nikolic, H.: Overcoming a challenge for Bohmian mechanics. arXiv preprint arXiv:2507.08049 (2025)

  11. [19]

    F., Wang, X

    Wang, Y. F., Wang, X. Y., Wang, H., and Lu, C. Y.: Tunnelling photons pose no challenge to Bohmian machanics. arXiv preprint arXiv:2507.20101 (2025)

  12. [20]

    Energy-speed relationship of quantum particles challenges Bohmian mechanics

    Drezet, A., Lazarovici, D., and Nabet, B. M.: Comment on “Energy-speed relationship of quantum particles challenges Bohmian mechanics”. arXiv preprint arXiv:2508.04756 (2025)

  13. [21]

    L., Nowakowski, M., Cohen, E

    Paiva, I. L., Nowakowski, M., Cohen, E. (2022). Dynamical nonlocality in quantum time via modular operators. Physical Review A, 105(4), 042207

  14. [22]

    Kedem, Y., Vaidman, L. (2010). Modular values and weak values of quantum observables. Physical Review Letters, 105(23), 230401

  15. [23]

    Cacheffo, A., Moussa, M. H. Y., De Ponte, M. A.: The double Caldeira-Leggett model: Derivation and solutions of the master equations, reservoir-induced interactions and decoherence. Physica A: Statistical Mechanics and its Applications, 389(11), 2198-2217 (2010)

  16. [24]

    V.: Dynamics of Quantum Correlations within the double Caldeira-Leggett formalism

    Mousavi, S. V.: Dynamics of Quantum Correlations within the double Caldeira-Leggett formalism. Euro. Phys. J. Plus, 140(12), 1165 (2025)

  17. [25]

    V.: Trajectory-based measure of nonlocality in the double Caldeira-Leggett formalism

    Mousavi, S. V.: Trajectory-based measure of nonlocality in the double Caldeira-Leggett formalism. Phys. Scr.,100(10), 105001 (2025)

  18. [26]

    V., Miret-Art´ es, S.: Dissipative two-identical-particle systems: diffraction and interference

    Mousavi, S. V., Miret-Art´ es, S.: Dissipative two-identical-particle systems: diffraction and interference. Euro. Phys. J. 17 Plus, 135(1), 83 (2020)

  19. [27]

    V., Miret-Art´ es, S.: Momentum-Space Decoherence of Distinguishable and Identical Particles in the Caldeira-Leggett Formalism

    Khani, Z., Mousavi, S. V., Miret-Art´ es, S.: Momentum-Space Decoherence of Distinguishable and Identical Particles in the Caldeira-Leggett Formalism. Entropy, 23(11), 1469 (2021)

  20. [28]

    S., and Paul, A.: Decoherence, entanglement negativity, and circuit complexity for an open quantum system

    Bhattacharyya, A., Hanif, T., Haque, S. S., and Paul, A.: Decoherence, entanglement negativity, and circuit complexity for an open quantum system. Physical Review D, 107(10), 106007 (2023)

  21. [29]

    H.: Decoherence and the transition from quantum to classical

    Zurek, W. H.: Decoherence and the transition from quantum to classical. Physics Today, 44(10), 36-44 (1991)

  22. [30]

    Lampo, A., March, M. ´A. G., Lewenstein, M.: Quantum Brownian motion revisited: extensions and applications. Springer, Cham: Springer International Publishing (2019)

  23. [31]

    Physics Reports, 831, 1-57 (2019)

    Schlosshauer, M.: Quantum decoherence. Physics Reports, 831, 1-57 (2019)

  24. [32]

    Venugopalan, A.: Preferred basis in a measurement process. Physical Review A, 50(3), 2742 (1994) Appendix A: Solution of the CL Equation for Superposed Gaussian Packets in a Gravitational Field In this appendix, we present the solution to the CL equation (36) for the initial s...

Pith tools

Reviewed May 22, 2026 · model on record in the stance chip above.