Pith. sign in

REVIEW 2 major objections 2 minor 34 references

Heavy element enrichment of gas in surface-accretion disks: A possible origin of the mass-metallicity anti-correlation in exoplanets

T0 review · 2 major / 2 minor · reviewed 2026-07-01 · grok-4.3

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read Surface accretion in protoplanetary disks enriches inner gas with heavy elements from slowly drifting fragile icy dust.

desk verdict The anti-correlation only appears under a fixed narrow surface-accretion profile that is not varied or derived from MHD. read the letter →

arxiv 2605.27289 v1 pith:OCPCTYBH submitted 2026-05-26 astro-ph.EP astro-ph.SR

Yoshitaka Ikeda , Kazumasa Ohno , Satoshi Okuzumi This is my paper · ORCID
classification astro-ph.EPastro-ph.SR
keywords protoplanetarydisksheavyelementenrichmentsurfaceaccretionicydustexoplanetatmospheresmass-metallicityanti-correlationmagnetohydrodynamicalwindssnowline
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper shows that when gas accretion occurs near the disk surface rather than throughout its thickness, the slow inward drift of fragile icy dust produces strong enrichment of water vapor inside the snow line. This enrichment occurs because surface accretion removes ice-free gas preferentially, leaving the vapor released by sublimating pebbles behind. The resulting water vapor concentration is an order of magnitude higher than in models with uniform accretion. The same process also creates an anti-correlation between the degree of enrichment and the mass of gas still left in the disk. This pattern matches the observed trend of higher atmospheric metallicity in lower-mass gas giant exoplanets.

What carries the argument

Surface-accretion disk model in which gas accretion flows are narrowly concentrated near the disk surface, enabling selective removal of ice-free gas while fragile icy dust drifts slowly.

What would settle it

A measurement showing that gas accretion flows are vertically uniform rather than surface-concentrated, or an observation of inner-disk water vapor abundance that does not anti-correlate with total disk gas mass, would falsify the central mechanism.

Watch

Extended reading notes

Core claim

In surface-accretion disk models driven by magnetohydrodynamical winds near the surface, the slow radial drift of fragile icy dust leads to water vapor enrichment inside the snow line by an order of magnitude higher than in uniform accretion models owing to selective removal of ice-free gas, and this produces an anti-correlation between inner-disk water vapor concentration and residual disk gas mass.

Load-bearing premise

Magnetohydrodynamical disk winds drive gas accretion near the disk surface rather than at the midplane, and icy dust remains fragile and drifts slowly at low temperatures.

Editorial extensions

If this is right

  • In uniform accretion models, fragile icy grains enhance water vapor abundance inside the snow line only by a factor of ~3.
  • Surface accretion produces water vapor enrichment higher by an order of magnitude through selective removal of ice-free gas.
  • The enrichment level anti-correlates with residual disk gas mass.
  • This anti-correlation is directly analogous to the observed anti-correlation between atmospheric metallicity and mass in extrasolar giant planets.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If surface accretion dominates in many disks, the timing of giant planet formation relative to disk gas depletion would control final atmospheric metallicity.
  • Direct mapping of vertical accretion flow structure in observed disks could confirm or rule out the selective gas removal process.
  • Atmospheric retrievals from JWST spectra of giant planets might be reinterpreted in light of when and where the planets accreted their gas.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

2 major / 2 minor

Summary. The manuscript simulates gas and dust evolution in protoplanetary disks under two accretion prescriptions (vertically uniform vs. surface-concentrated). It claims that, when gas accretion is narrowly concentrated near the disk surface (as might be driven by MHD winds), the slow drift of fragile icy dust produces order-of-magnitude water-vapor enrichment inside the snow line via selective removal of ice-free gas; this enrichment anti-correlates with residual disk gas mass, offering a dynamical origin for the observed mass-metallicity anti-correlation in giant exoplanets. The uniform-accretion case yields only ~3× enrichment and no anti-correlation.

Significance. If the surface-accretion profile can be justified, the work supplies a mechanism for heavy-element enrichment that is consistent with fragile icy dust and does not require rapid pebble drift. The anti-correlation emerges directly from the selective-removal dynamics rather than from fitting to exoplanet data, which is a conceptual strength. The simulations incorporate radial transport, collisional growth/fragmentation, and H2O phase changes, providing a self-consistent treatment of the coupled gas-dust system.

major comments (2)
  1. [surface-accretion disk model] Surface-accretion model: the anti-correlation between inner-disk water-vapor concentration and residual gas mass appears only in the surface-accretion run, which assumes a narrowly concentrated vertical profile for the accretion flow. No parameter exploration varies the width or radial dependence of this profile (listed as a free parameter), nor is the profile taken from a self-consistent MHD calculation. Because the uniform-accretion model produces neither the order-of-magnitude enrichment nor the anti-correlation, the specific functional form of the surface flow is load-bearing for the central claim.
  2. [results] Results: the reported enrichment factors and anti-correlation are presented as qualitative outcomes of the simulations. No resolution or convergence tests, error estimates on the vapor concentrations, or direct quantitative mapping to observed exoplanet metallicity-mass relations are provided, so the robustness of the analogy cannot be assessed from the given data.
minor comments (2)
  1. [model description] The abstract and model sections would benefit from an explicit equation or figure showing the vertical functional form adopted for the surface accretion flow.
  2. Figure captions should state the exact parameter values used for the surface-accretion width so that the runs can be reproduced.

Simulated Author's Rebuttal

2 responses · 0 unresolved

We thank the referee for their constructive and insightful comments. We address each major comment point by point below.

read point-by-point responses

  1. Referee: Surface-accretion model: the anti-correlation between inner-disk water-vapor concentration and residual gas mass appears only in the surface-accretion run, which assumes a narrowly concentrated vertical profile for the accretion flow. No parameter exploration varies the width or radial dependence of this profile (listed as a free parameter), nor is the profile taken from a self-consistent MHD calculation. Because the uniform-accretion model produces neither the order-of-magnitude enrichment nor the anti-correlation, the specific functional form of the surface flow is load-bearing for the central claim.

    Authors: We agree that the narrowly concentrated surface-accretion profile is central to the order-of-magnitude enrichment and the emergence of the anti-correlation, as demonstrated by the contrast with the uniform-accretion case. The profile is adopted as a simplified representation of accretion driven by magnetohydrodynamical winds, which theoretical work indicates operate preferentially in the disk surface layers. While the manuscript does not vary the width or extract the profile from a specific MHD simulation, the key dynamical effect is the selective removal of ice-free gas when accretion is surface-concentrated. In the revised manuscript we will add a limited parameter exploration of the accretion-layer width to quantify sensitivity. revision: yes

  2. Referee: Results: the reported enrichment factors and anti-correlation are presented as qualitative outcomes of the simulations. No resolution or convergence tests, error estimates on the vapor concentrations, or direct quantitative mapping to observed exoplanet metallicity-mass relations are provided, so the robustness of the analogy cannot be assessed from the given data.

    Authors: We acknowledge that the current manuscript presents the enrichment factors and anti-correlation without accompanying resolution or convergence tests, error estimates, or a quantitative fit to exoplanet data. The results are shown for our fiducial simulations to illustrate the mechanism. In revision we will incorporate resolution tests at multiple grid sizes, report uncertainties on the vapor concentrations, and expand the discussion to include a more direct (though still illustrative) comparison with the observed mass-metallicity trend. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity; anti-correlation is dynamical outcome of stated surface-accretion assumption

full rationale

The paper runs two explicit disk-evolution simulations (uniform vs. surface accretion) and reports that the anti-correlation between inner-disk water-vapor concentration and residual gas mass appears only in the surface-accretion case because ice-free gas is selectively removed while fragile dust drifts slowly. This is a direct numerical consequence of the imposed vertical accretion profile and the fragility/drift assumptions; it is not obtained by fitting any parameter to exoplanet metallicity data, nor is any result defined in terms of itself. No self-citations are invoked to justify uniqueness of the profile or to smuggle an ansatz. The profile width is an input assumption whose consequences are contrasted with the uniform case, satisfying the criterion for an independent derivation chain.

Assumptions & free parameters 1 free parameters · 2 assumptions · 0 invented entities

Review is based on abstract only; the model rests on the stated assumptions about accretion geometry and dust fragility without independent verification of those premises.

free parameters (1)
  • vertical concentration of accretion flow
    Chosen to represent surface accretion; value not specified in abstract.
assumptions (2)
  • domain assumption MHD winds drive gas accretion near the disk surface
    Invoked to justify the surface-accretion geometry.
  • domain assumption Icy dust is fragile and drifts slowly at low temperatures
    Cited from recent disk observations and experiments.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Heavy element enrichment of gas in surface-accretion disks: A possible origin of the mass-metallicity anti-correlation in exoplanets." pith.science (2026). https://pith.science/paper/OCPCTYBH

@misc{pith2026260527289,
  author       = {Pith},
  title        = {Pith review of: Heavy element enrichment of gas in surface-accretion disks: A possible origin of the mass-metallicity anti-correlation in exoplanets},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/OCPCTYBH}},
  note         = {Machine review of arXiv:2605.27289}
}
abstract

Recent observations, including those by JWST, suggest that the atmospheres of many gas giant exoplanets have super-stellar metallicity that is anti-correlated with planetary mass. Several studies suggest that the super-stellar metallicity can be explained by accretion of vapor-enriched disk gas produced by the sublimation of rapidly drifting icy pebbles. However, recent disk observations and experiments suggest that icy dust is fragile at low temperatures, calling into question the conventional picture that icy grains grow efficiently and drift rapidly. We present a new scenario for heavy-element enrichment in the inner disk by fragile, slowly drifting icy dust, assuming that magnetohydrodynamical disk winds drive gas accretion near the disk surface rather than at the midplane. We simulate the evolution of gas and dust in a surface-accretion disk, taking into account the radial transport of gas and dust, collision growth and fragmentation of fragile dust, and the condensation and sublimation of H2O. Two accretion disk models are presented, in which gas accretion flows are assumed to be either vertically uniform or narrowly concentrated near the disk surface. In the uniform accretion disk model, fragile icy grains enhance the water vapor abundance inside the snow line only by a factor of ${\sim}3$ due to their slow drift. In contrast, in the surface-accretion disk model, the slow drift of icy dust leads to water vapor enrichment that is higher by an order of magnitude, owing to the selective removal of ice-free gas from the disk. Furthermore, surface accretion yields an anti-correlation between the water vapor concentration in the inner disk and the residual disk gas mass, analogous to the anti-correlation between atmospheric metallicity and planet mass observed in extrasolar giant planets.

Figures

Figures reproduced from arXiv: 2605.27289 by the authors.

Figure 1
Figure 1. Atmospheric oxygen abundances for hot to warm giant exoplan￾ets as a function of planet mass (in units of Jupiter mass MJ). The abun￾dances are expressed as [O/H] = log10(O/H) − log10(O/H)⊙, adopting solar abundances from Asplund et al. (2009). Purple and orange points denote values inferred from emission and transmission observations. The data and fitted curves are compiled from the ExoComp database (Lothringer et … view at source ↗
Figure 2
Figure 2. Schematic illustration of gas and dust transport in disks with ver￾tically uniform and surface accretion (upper and lower panels, respec￾tively). Vertically uniform gas transports dust at all heights, whereas accretion concentrated at height (denoted by z = zs) does not transport dust below this height. As ice-bearing dust grains in the outer disk re￾gion move in and cross the snow line (vertical line), they release… view at source ↗
Figure 3
Figure 3. Evolution of the water vapor concentration ΣH2O,g/(Σg + ΣH2O,g) in the uniform and surface-accretion disk models (left and right panels, respectively) with vstick = 0.3 m s−1 . The dashed lines indicate vapor concentrations of 1 and 10 wt%. The dotted line marks the snow line. and ⟨v wind g,r ⟩g by dimensionless parameters, αvisc and αwind (Eqs. (A.3) and (A.4)). We set αvisc = 3 × 10−4 and αwind = 6 × 10−3 througho… view at source ↗
Figures from the paper (1 more)
Figure 4
Figure 4. Figure 4: Water vapor enrichment (see text for definition) in the inner disk, measured at r = 0.3 au, as a function of the residual gas mass of the entire disk, Mg. The time corresponding to the residual disk gas mass is shown on the top horizontal axis. The orange and blue line…

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

34 extracted references · 34 canonical work pages

  1. [1]

    2025, , 170, 67

    Arulanantham , N., Salyk , C., Pontoppidan , K., et al. 2025, , 170, 67

    work page 2025

  2. [2]

    J., & Scott , P

    Asplund , M., Grevesse , N., Sauval , A. J., & Scott , P. 2009, , 47, 481

    work page 2009

  3. [3]

    2017, , 845, 75

    Bai , X.-N. 2017, , 845, 75

    work page 2017

  4. [4]

    M., et al

    Banzatti , A., Salyk , C., Pontoppidan , K. M., et al. 2025, , 169, 165

    work page 2025

  5. [5]

    L., Xue , Q., August , P

    Bean , J. L., Xue , Q., August , P. C., et al. 2023, , 618, 43

    work page 2023

  6. [6]

    P., & Brauer , F

    Birnstiel , T., Dullemond , C. P., & Brauer , F. 2009, , 503, L5

    work page 2009

  7. [7]

    A., Clarke , C

    Booth , R. A., Clarke , C. J., Madhusudhan , N., & Ilee , J. D. 2017, , 469, 3994

    work page 2017

  8. [8]

    & Tielens , A

    Dominik , C. & Tielens , A. G. G. M. 1997, , 480, 647

    work page 1997

Show all 34 references
  1. [9]

    D., Radica , M., Welbanks , L., et al

    Feinstein , A. D., Radica , M., Welbanks , L., et al. 2023, , 614, 670

    2023

  2. [10]

    J., Mordasini , C., Nettelmann , N., et al

    Fortney , J. J., Mordasini , C., Nettelmann , N., et al. 2013, , 775, 80

    2013

  3. [11]

    B., Sing , D

    Fu , G., Stevenson , K. B., Sing , D. K., et al. 2025, , 986, 1

    2025

  4. [12]

    2024, , 632, 752

    Fu , G., Welbanks , L., Deming , D., et al. 2024, , 632, 752

    2024

  5. [13]

    J., Nelson , R

    Gressel , O., Turner , N. J., Nelson , R. P., & McNally , C. P. 2015, , 801, 84

    2015

  6. [14]

    P., Kreuzig , C., et al

    Gundlach , B., Schmidt , K. P., Kreuzig , C., et al. 2018, , 479, 1273

    2018

  7. [15]

    & Bai , X.-N

    Hu , Z. & Bai , X.-N. 2021, , 503, 162

    2021

  8. [16]

    Iwasaki , K., Tomida , K., Takasao , S., Okuzumi , S., & Suzuki , T. K. 2024, , 76, 616

    2024

  9. [17]

    M., & Carrasco-Gonz \'a lez , C

    Jiang , H., Mac \' as , E., Guerra-Alvarado , O. M., & Carrasco-Gonz \'a lez , C. 2024, , 682, A32

    2024

  10. [18]

    Kempton , E. M. R. & Knutson , H. A. 2024, Reviews in Mineralogy and Geochemistry, 90, 411

    2024

  11. [19]

    Lesur , G. R. J. 2021, , 650, A35

    2021

  12. [20]

    2025, , 978, L30

    Long , F., Pascucci , I., Houge , A., et al. 2025, , 978, L30

    2025

  13. [21]

    D., Lowson , N., & Fu , G

    Lothringer , J. D., Lowson , N., & Fu , G. 2026, , 171, 31

    2026

  14. [22]

    & Wurm , G

    Musiolik , G. & Wurm , G. 2019, , 873, 58

    2019

  15. [23]

    2026, , 78, 493

    Ohno , K., Ikoma , M., Okuzumi , S., & Kimura , T. 2026, , 78, 493

    2026

  16. [24]

    2025, , 77, 162

    Okuzumi , S. 2025, , 77, 162

    2025

  17. [25]

    & Tazaki , R

    Okuzumi , S. & Tazaki , R. 2019, , 878, 132

    2019

  18. [26]

    2016, , 589, A15

    Sato , T., Okuzumi , S., & Ida , S. 2016, , 589, A15

    2016

  19. [27]

    Schneider , A. D. & Bitsch , B. 2021, , 654, A71

    2021

  20. [28]

    Shakura , N. I. & Sunyaev , R. A. 1973, , 24, 337

    1973

  21. [29]

    2023, , 519, 1713

    Shibata , S., Helled , R., & Kobayashi , H. 2023, , 519, 1713

    2023

  22. [30]

    P., Cridland , A

    Tabone , B., Rosotti , G. P., Cridland , A. J., Armitage , P. J., & Lodato , G. 2022, , 512, 2290

    2022

  23. [31]

    2024, Nature Astronomy, 8, 1148

    Ueda , T., Tazaki , R., Okuzumi , S., Flock , M., & Sudarshan , P. 2024, Nature Astronomy, 8, 1148

    2024

  24. [32]

    F., et al

    Welbanks , L., Madhusudhan , N., Allard , N. F., et al. 2019, , 887, L20

    2019

  25. [33]

    , " * write output.state after.block = add.period write newline

    ENTRY address archiveprefix author booktitle chapter edition editor howpublished institution eprint journal key month note number organization pages publisher school series title type volume year label extra.label sort.label short.list INTEGERS output.state before.all mid.sent...

  26. [34]

    write newline

    " write newline "" before.all 'output.state := FUNCTION n.dashify 't := "" t empty not t #1 #1 substring "-" = t #1 #2 substring "--" = not "--" * t #2 global.max substring 't := t #1 #1 substring "-" = "-" * t #2 global.max substring 't := while if t #1 #1 substring * t #2 gl...

Pith tools

Reviewed July 1, 2026 · model on record in the stance chip above.