Pith. sign in

REVIEW 2 major objections 1 minor 29 references

Structures Facilitate Retrieve, Rerank, and Generate

T0 review · 2 major / 1 minor · reviewed 2026-06-28 · grok-4.3

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read Document structure improves retrieval, reranking, and generation in document-grounded dialogue systems.

desk verdict SF-Re2G adds structure across retrieve-rerank-generate for DGDS but the experimental support is thin and the key neighborhood assumption is unmeasured. read the letter →

arxiv 2606.03247 v1 pith:KILLB7VK submitted 2026-06-02 cs.CL cs.IR

Yeqin Zhang , Haomin Fu , Xujie Zhang , Cam-Tu Nguyen This is my paper · ORCID
classification cs.CLcs.IR
keywords document-groundeddialoguesystemspassageretrievalrerankingdocumentstructureresponsegenerationsubgraph
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper proposes SF-Re2G to address limitations in existing DGDS methods that treat document passages independently. It enhances retrieval by contrasting each passage representation with others from the same section. A structure-enhanced reranker groups retrieval candidates into subgraphs based on document neighborhoods to integrate group information when rescoring. Generation then incorporates the subgraph context around selected passages. Results on two datasets show gains for both Chinese and English.

What carries the argument

The structure-enhanced reranker, which groups retrieval candidates into subgraphs by document structure and rescores each candidate by integrating its group information.

What would settle it

An experiment in which rescoring candidates using their subgraph group information yields no accuracy gain over independent candidate scoring.

Watch

Extended reading notes

Core claim

By grouping candidates into subgraphs according to document structure for the reranker, while using section contrasts for retrieval and subgraph context for generation, the method improves knowledge selection and response quality over independent-passage baselines.

Load-bearing premise

Multiple grounding passages for one dialog turn tend to be located in the same neighborhood within the document structure.

Editorial extensions

If this is right

  • Passage representations become more discriminative when each is contrasted against others from the same section.
  • Reranking accuracy rises when candidate scores incorporate information from their structural neighborhood group.
  • Response generation improves when the model conditions on the subgraph context around chosen passages.
  • The combined approach produces measurable gains on two DGDS datasets in both Chinese and English.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The neighborhood-grouping idea could be applied to other retrieval tasks over hierarchically organized documents.
  • Benefits may increase with document length, as neighborhoods become more informative.
  • The three-stage structure could be combined with dense retrieval encoders without changing the core grouping logic.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

2 major / 1 minor

Summary. The manuscript proposes SF-Re2G for document-grounded dialogue systems. It improves passage retrieval via contrastive learning against other passages from the same section, builds a structure-enhanced reranker that groups retrieval candidates into subgraphs according to document neighborhoods, and incorporates subgraph context during response generation. The central claim is that experimental results on two DGDS datasets validate the approach for both Chinese and English.

Significance. If the empirical gains are shown to be robust via proper controls, the work could usefully demonstrate how document structure can be exploited across the retrieve-rerank-generate pipeline in DGDS. The neighborhood grouping idea is a direct response to a known limitation of passage-independent methods.

major comments (2)
  1. [Abstract] The abstract states that 'experimental results on two DGDS datasets validate our method,' yet supplies no baselines, metrics, effect sizes, ablation results, or error analysis. This information is load-bearing for the validation claim and must be supplied with concrete numbers and statistical support.
  2. [Reranker description] The structure-enhanced reranker is justified by the assumption that 'multiple grounding passages of one dialog turn tend to be in the same neighborhood.' No independent measurement, frequency statistics, or dataset analysis is provided to quantify how often this co-occurrence actually holds, so it is unclear whether reported gains derive from the subgraph grouping or from other modeling choices such as contrastive section embeddings.
minor comments (1)
  1. [Abstract] The abstract should name the two DGDS datasets and the primary evaluation metrics used for retrieval, reranking, and generation.

Simulated Author's Rebuttal

2 responses · 0 unresolved

We thank the referee for the constructive feedback. We address the two major comments below and will incorporate revisions to strengthen the manuscript.

read point-by-point responses

  1. Referee: [Abstract] The abstract states that 'experimental results on two DGDS datasets validate our method,' yet supplies no baselines, metrics, effect sizes, ablation results, or error analysis. This information is load-bearing for the validation claim and must be supplied with concrete numbers and statistical support.

    Authors: We agree that the abstract would be strengthened by including key quantitative results. In the revised version, we will expand the abstract to report specific metrics (e.g., retrieval recall, reranking NDCG, generation BLEU/ROUGE), baseline comparisons, effect sizes, and mention of ablations with statistical support from the two datasets. revision: yes

  2. Referee: [Reranker description] The structure-enhanced reranker is justified by the assumption that 'multiple grounding passages of one dialog turn tend to be in the same neighborhood.' No independent measurement, frequency statistics, or dataset analysis is provided to quantify how often this co-occurrence actually holds, so it is unclear whether reported gains derive from the subgraph grouping or from other modeling choices such as contrastive section embeddings.

    Authors: The modeling choice is motivated by patterns observed during dataset exploration, but we acknowledge the absence of explicit quantification in the current manuscript. We will add a dedicated analysis subsection that reports frequency statistics on neighborhood co-occurrence of grounding passages across the two DGDS datasets, including breakdowns by dialog turn and document structure, to clarify the contribution of subgraph grouping. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity

full rationale

The paper describes an empirical pipeline (contrastive section embeddings for retrieval, subgraph grouping of candidates for reranking based on an explicit neighborhood assumption, and subgraph-context generation) validated on two DGDS datasets. No equations, parameter fitting, derivations, or self-citation chains are present that reduce any claimed result to its inputs by construction. The neighborhood assumption is stated outright rather than derived or smuggled via self-citation, and performance claims rest on external experimental outcomes rather than internal self-reference.

Assumptions & free parameters 0 free parameters · 2 assumptions · 0 invented entities

The approach rests on domain assumptions about document structure rather than new mathematical axioms or invented entities; no free parameters are identifiable from the abstract.

assumptions (2)
  • domain assumption Document structure provides useful neighborhood signals for identifying multiple grounding passages of a single dialog turn
    Explicitly invoked to justify the subgraph grouping in the reranker
  • domain assumption Contrasting a passage with others from the same section yields improved retrieval representations
    Basis for the first component of the method

how reviews work

0 comments
Cite this review

Pith. "Pith review of Structures Facilitate Retrieve, Rerank, and Generate." pith.science (2026). https://pith.science/paper/KILLB7VK

@misc{pith2026260603247,
  author       = {Pith},
  title        = {Pith review of: Structures Facilitate Retrieve, Rerank, and Generate},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/KILLB7VK}},
  note         = {Machine review of arXiv:2606.03247}
}
read the original abstract

Document-grounded dialogue systems (DGDS) utilize knowledge from external documents to answer domain-specific user questions. Existing solutions typically divide documents into independent passages for retrieval and response generation. This approach, however, neither makes good use of structural information within documents nor provides enough (document) context for knowledge selection and responses. This paper proposes SF-Re2G to address such issues systematically. Firstly, we seek to improve a passage representation by contrasting it with others of the same section, thus improving the retrieval performance. Secondly, a structure-enhanced reranker is built, leveraging the fact that multiple grounding passages of one dialog turn tend to be in the same neighborhood. Specifically, candidates from the retrieval are grouped into subgraphs according to the document structure. The reranker will rescore the candidate integrating its group information. Finally, the chosen passages are used for responses, taking into account the subgraph context for better generation. Experimental results on two DGDS datasets validate our method for both Chinese and English.

Figures

Figures reproduced from arXiv: 2606.03247 by the authors.

Figure 1
Figure 1. An example from Doc2Bot dataset. The left is a dialogue, and the right is a grounding document. The document is divided into several passages. Each step in the document and each cell in the table is treated as a passage. arXiv:2606.03247v1 [cs.CL] 2 Jun 2026 [PITH_FULL_IMAGE:figures/full_fig_p001_1.png] view at source ↗
Figure 2
Figure 2. The architecture of SF-Re2G. Like Re2G, SF-Re2G consists of a retrieval module, a rerank module, and a generation module. For retrieval, we design Structural Contrastive to enhance the negative sampling. For rerank and generation, we construct a subgraph for each passage to fuse more information. 3 Methodology The problem of DGDS can be described as follows. Assuming a collection of D doc￾uments, we split each docum… view at source ↗
Figure 3
Figure 3. The architecture of the Reranker. 3.2 Reranker As a bridge between the retrieval module and generation module, on the one hand, a Reranker needs to rescore the candidates from the Retrieval through the cross-encoder structure, which is more time-consuming but more accurate than the bi-encoder struc￾ture to obtain a more effective score. On the other hand, the rerank rescores the candi￾dates and directly affects the … view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

29 extracted references · 2 canonical work pages

  1. [1]

    In: Proceedings of the 45th International ACM SIGIR Conference on Research and Development in Information Retrieval (2022)

    Dong, Q., Liu, Y ., Cheng, S., Wang, S., Cheng, Z., Niu, S., Yin, D.: Incorporating explicit knowledge in pre-trained language models for passage re-ranking. In: Proceedings of the 45th International ACM SIGIR Conference on Research and Development in Information Retrieval (2022)

    2022

  2. [2]

    In: Proceedings of the 2021 Conference on Empirical Methods in Natural Language Processing (2021)

    Feng, S., Patel, S.S., Wan, H., Joshi, S.: Multidoc2dial: Modeling dialogues grounded in mul- tiple documents. In: Proceedings of the 2021 Conference on Empirical Methods in Natural Language Processing (2021)

    2021

  3. [3]

    In: Proceedings of the 2020 Conference on Empirical Methods in Natural Language Processing (2020)

    Feng, S., Wan, H., Gunasekara, C., Patel, S., Joshi, S., Lastras, L.: doc2dial: A goal-oriented document-grounded dialogue dataset. In: Proceedings of the 2020 Conference on Empirical Methods in Natural Language Processing (2020)

    2020

  4. [4]

    In: Findings of the Association for Computational Linguistics (2022)

    Feng, Y ., Han, Z., Sun, M., Li, P.: Multi-hop open-domain question answering over structured and unstructured knowledge. In: Findings of the Association for Computational Linguistics (2022)

    2022

  5. [5]

    Findings of the Association for Computational Linguistics (2022)

    Fu, H., Zhang, Y ., Yu, H., Sun, J., Huang, F., Si, L., Li, Y ., Nguyen, C.T.: Doc2bot: Ac- cessing heterogeneous documents via conversational bots. Findings of the Association for Computational Linguistics (2022)

    2022

  6. [6]

    In: Proceedings of the 60th Annual Meeting of the Association for Computational Linguistics: Student Research Work- shop (2022)

    Fu, Y .: Towards unification of discourse annotation frameworks. In: Proceedings of the 60th Annual Meeting of the Association for Computational Linguistics: Student Research Work- shop (2022)

    2022

  7. [7]

    In: Proceedings of the 60th Annual Meeting of the Association for Computational Linguistics (2022)

    Gao, C., Zhang, W., Lam, W.: UniGDD: A unified generative framework for goal-oriented document-grounded dialogue. In: Proceedings of the 60th Annual Meeting of the Association for Computational Linguistics (2022)

    2022

  8. [8]

    In: Proceedings of the AAAI Conference on Artificial Intelligence (2018)

    Ghazvininejad, M., Brockett, C., Chang, M.W., Dolan, B., Gao, J., Yih, W.t., Galley, M.: A knowledge-grounded neural conversation model. In: Proceedings of the AAAI Conference on Artificial Intelligence (2018)

    2018

Show all 29 references
  1. [9]

    In: Proceedings of the 2022 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies (2022)

    Glass, M., Rossiello, G., Chowdhury, M.F.M., Naik, A., Cai, P., Gliozzo, A.: Re2G: Retrieve, rerank, generate. In: Proceedings of the 2022 Conference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies (2022)

    2022

  2. [10]

    In: Proceedings of the 16th Conference of the European Chapter of the Association for Computational Linguistics (2021)

    Izacard, G., Grave, E.: Leveraging passage retrieval with generative models for open domain question answering. In: Proceedings of the 16th Conference of the European Chapter of the Association for Computational Linguistics (2021)

    2021

  3. [11]

    In: Proceedings of the 2020 Confer- ence on Empirical Methods in Natural Language Processing (2020) 12 Anonymous Author(s)

    Karpukhin, V ., Oguz, B., Min, S., Lewis, P., Wu, L., Edunov, S., Chen, D., Yih, W.t.: Dense passage retrieval for open-domain question answering. In: Proceedings of the 2020 Confer- ence on Empirical Methods in Natural Language Processing (2020) 12 Anonymous Author(s)

    2020

  4. [12]

    In: Proceedings of the 2021 Conference on Empirical Methods in Natural Language Processing (2021)

    Lakhotia, K., Paranjape, B., Ghoshal, A., Yih, S., Mehdad, Y ., Iyer, S.: FiD-ex: Improving sequence-to-sequence models for extractive rationale generation. In: Proceedings of the 2021 Conference on Empirical Methods in Natural Language Processing (2021)

    2021

  5. [13]

    In: Proceedings of the SIGCHI conference on Human factors in computing systems (1995)

    Lamping, J., Rao, R., Pirolli, P.: A focus+ context technique based on hyperbolic geome- try for visualizing large hierarchies. In: Proceedings of the SIGCHI conference on Human factors in computing systems (1995)

    1995

  6. [14]

    In: Proceedings of the 58th annual meeting of the association for computational linguistics (2020)

    Lewis, M., Liu, Y ., Goyal, N., Ghazvininejad, M., Mohamed, A., Levy, O., Stoyanov, V ., Zettlemoyer, L.: Bart: Denoising sequence-to-sequence pre-training for natural language generation, translation, and comprehension. In: Proceedings of the 58th annual meeting of the associ...

    2020

  7. [15]

    Advances in neural information processing systems (2020)

    Lewis, P., Perez, E., Piktus, A., Petroni, F., Karpukhin, V ., Goyal, N., Küttler, H., Lewis, M., Yih, W.t., Rocktäschel, T., et al.: Retrieval-augmented generation for knowledge-intensive nlp tasks. Advances in neural information processing systems (2020)

    2020

  8. [16]

    In: Proceedings of the 57th Annual Meeting of the Association for Computational Linguistics (2019)

    Li, Z., Niu, C., Meng, F., Feng, Y ., Li, Q., Zhou, J.: Incremental transformer with deliberation decoder for document grounded conversations. In: Proceedings of the 57th Annual Meeting of the Association for Computational Linguistics (2019)

    2019

  9. [17]

    In: Text summarization branches out (2004)

    Lin, C.Y .: Rouge: A package for automatic evaluation of summaries. In: Text summarization branches out (2004)

    2004

  10. [18]

    In: Proceedings of the 58th an- nual meeting of the association for computational linguistics (2020)

    Lin, X., Jian, W., He, J., Wang, T., Chu, W.: Generating informative conversational response using recurrent knowledge-interaction and knowledge-copy. In: Proceedings of the 58th an- nual meeting of the association for computational linguistics (2020)

    2020

  11. [19]

    ACM Transactions on Information Systems (2021)

    Ma, L., Li, M., Zhang, W.N., Li, J., Liu, T.: Unstructured text enhanced open-domain dia- logue system: A systematic survey. ACM Transactions on Information Systems (2021)

    2021

  12. [20]

    In: Proceedings of the AAAI conference on artificial intelligence (2020)

    Meng, C., Ren, P., Chen, Z., Monz, C., Ma, J., de Rijke, M.: Refnet: A reference-aware network for background based conversation. In: Proceedings of the AAAI conference on artificial intelligence (2020)

    2020

  13. [21]

    CoRR (2019)

    Nogueira, R.F., Cho, K.: Passage re-ranking with BERT. CoRR (2019)

    2019

  14. [22]

    In: Proceedings of the Third Confer- ence on Machine Translation: Research Papers (2018)

    Post, M.: A call for clarity in reporting BLEU scores. In: Proceedings of the Third Confer- ence on Machine Translation: Research Papers (2018)

    2018

  15. [23]

    Now Publishers Inc (2009)

    Robertson, S., Zaragoza, H.: The probabilistic relevance framework: BM25 and beyond. Now Publishers Inc (2009)

    2009

  16. [24]

    In: Proceedings of the 57th Annual Meeting of the Association for Computational Linguistics (2019)

    Tao, C., Wu, W., Xu, C., Hu, W., Zhao, D., Yan, R.: One time of interaction may not be enough: Go deep with an interaction-over-interaction network for response selection in di- alogues. In: Proceedings of the 57th Annual Meeting of the Association for Computational Linguistics (2019)

    2019

  17. [25]

    In: Proceedings of the 2021 Con- ference of the North American Chapter of the Association for Computational Linguistics: Human Language Technologies (2021)

    Wan, H., Feng, S., Gunasekara, C., Patel, S.S., Joshi, S., Lastras, L.: Does structure matter? encoding documents for machine reading comprehension. In: Proceedings of the 2021 Con- ference of the North American Chapter of the Association for Computational Linguistics: Human L...

    2021

  18. [26]

    arXiv preprint arXiv:1911.09728 (2019)

    Wang, X., Weston, J., Auli, M., Jernite, Y .: Improving conditioning in context-aware se- quence to sequence models. arXiv preprint arXiv:1911.09728 (2019)

    1911

  19. [27]

    In: Proceedings of the AAAI Conference on Artificial Intelligence (2022)

    Zhang, Y ., Sun, S., Gao, X., Fang, Y ., Brockett, C., Galley, M., Gao, J., Dolan, B.: Retgen: A joint framework for retrieval and grounded text generation modeling. In: Proceedings of the AAAI Conference on Artificial Intelligence (2022)

    2022

  20. [28]

    arXiv preprint arXiv:2002.10348 (2020)

    Zhao, X., Wu, W., Tao, C., Xu, C., Zhao, D., Yan, R.: Low-resource knowledge-grounded dialogue generation. arXiv preprint arXiv:2002.10348 (2020)

    2002

  21. [29]

    In: Proceedings of the 56th Annual Meeting of the Association for Computational Linguistics (2018)

    Zhou, X., Li, L., Dong, D., Liu, Y ., Chen, Y ., Zhao, W.X., Yu, D., Wu, H.: Multi-turn response selection for chatbots with deep attention matching network. In: Proceedings of the 56th Annual Meeting of the Association for Computational Linguistics (2018)

    2018

Pith tools

Reviewed June 28, 2026 · model on record in the stance chip above.