Direct High-Magnetic-Field Coupling to Stripe Order in a Cuprate Superconductor

Adheena Painganoor; Alexander Pelka; Ana Kurtanidze; Atsuhiko Miyata; Azat Khadiev; Benedikt Eggert; Bj\"orn N\"aser; Carsten Baehtz; Cornelius Strohm; Dmitri V. Novikov

REVIEW 3 major objections 2 minor 293 references

Direct High-Magnetic-Field Coupling to Stripe Order in a Cuprate Superconductor

T0 review · 3 major / 2 minor · reviewed 2026-06-27 · grok-4.3

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read High magnetic fields linearly enhance charge stripe order amplitude and length in a cuprate far above the vortex melting transition.

desk verdict The paper shows linear growth of charge order with field above vortex melting using pulsed FEL diffraction, suggesting direct stripe coupling, but the abstract leaves artifact risks and data details unaddressed. read the letter →

arxiv 2606.07349 v1 pith:MRCTWRNM submitted 2026-06-05 cond-mat.str-el cond-mat.supr-con

Leonardo Martinelli , Izabela Bia{l}o , Jens Oppliger , Julia Küspert , Orion Gerguri , Sandro Brunner , Benedikt Eggert , Mark H. Fischer

show 42 more authors

Jochen Geck Marein Rahn Ellen Fogh Jaewon Choi Atsuhiko Miyata Oleksandr Prokhnenko Zahirul Islam Fernando Igoa Saldaña Martin v. Zimmermann Rachel Nickel Kurt Kummer Nicholas B. Brookes Adheena Painganoor Paola Caterina Forino Rasmus Toft-Petersen Niels Bech Christensen Xunyang Hong Qisi Wang Tohru Kurosawa Naoki Momono Migaku Oda Dmitri V. Novikov Azat Khadiev Thomas Herrmannsdörfer Ana Kurtanidze Katharina Ollefs Zuzana Konôpková Micha{l} Andrzejewski Minxue Tang Ulf Zastrau Alexander Pelka Hauke Höppner Jolanta Sztuk-Dambietz Vratko Rovensky Torsten Laurus Erik Brambrink Björn Näser Marcin Sikora Cornelius Strohm Carsten Baehtz Shingo Yamamoto Johan Chang

This is my paper · ORCID

classification cond-mat.str-elcond-mat.supr-con

keywords cupratesuperconductorsstripeorderchargedensitywavehighmagneticfieldsx-raydiffractionnormalstatevortexmeltingspinfreezing

verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper synchronizes free-electron laser x-rays with pulsed fields up to 44 T to probe the normal state of a cuprate superconductor. It measures a linear rise in charge order amplitude and correlation length that continues well past the point where superconductivity is destroyed. This linear dependence rules out simple competition between charge order and superconductivity as the sole explanation. Magnetostriction data show that field-induced lattice distortions occur but are weaker and secondary. The findings, paired with known field-linear spin freezing, indicate a direct coupling of the applied field to the spin part of stripe order that scattering experiments had not previously isolated.

What carries the argument

Direct magnetic-field coupling to the spin component of stripe order, revealed by the linear field dependence of charge-order parameters measured by synchronized x-ray diffraction.

What would settle it

A measurement in which charge order amplitude or correlation length saturates, decreases, or shows non-linear behavior with increasing field above the vortex melting transition, after independent verification that pulsed-field and synchronization artifacts are absent.

Watch

Extended reading notes

Core claim

In the high-field normal state, the amplitude and correlation length of charge stripe order increase linearly with magnetic field strength, persisting beyond the vortex melting transition. This response is incompatible with phase competition models that tie charge order solely to the suppression of superconductivity. Magnetostriction measurements confirm that monoclinic lattice distortions also grow with field, yet these distortions are weaker than the charge order enhancement and appear as a secondary effect. Combined with observations of field-linear spin freezing, the data establish a direct coupling between the magnetic field and the spin component of the stripe order.

Load-bearing premise

The observed linear increase in charge order amplitude and correlation length with field is free of significant artifacts from the pulsed-field environment or from timing synchronization between the x-ray pulses and the magnetic field pulses.

Editorial extensions

If this is right

Charge order can be strengthened by magnetic field in the absence of superconductivity.
Standard models of direct competition between charge order and superconductivity cannot account for the field dependence.
Magnetoelastic lattice distortions are secondary and do not drive the primary stripe-order enhancement.
Scattering techniques can now detect a field-spin coupling channel in the normal state that was previously inaccessible.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

The same direct coupling may stabilize stripe order in other cuprate compositions or under different tuning parameters without requiring superconductivity suppression.
High-field experiments could be extended to track whether this spin-field interaction influences the pseudogap or strange-metal regimes at still higher fields.
If the coupling is intrinsic to the spin texture, analogous linear responses might appear in spin-density-wave systems outside the cuprates when probed with synchronized x-ray and pulsed-field methods.

Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Desk Editor's Note

read the letter

The main point is that charge order amplitude and correlation length keep rising linearly with magnetic field well past the vortex melting line in this cuprate, which the authors say rules out simple competition with superconductivity and instead points to a direct field coupling to the spin part of the stripes.

They achieve this by synchronizing FEL x-rays with 44 T pulses and cross-check with standard hard x-ray diffraction plus magnetostriction measurements that show weaker lattice changes. They link the result to earlier field-linear spin freezing work.

The experimental reach into the high-field normal state with time-resolved diffraction is the clear technical step forward, and the linear persistence is presented as new.

The soft spot is exactly the one in the stress test: the abstract gives no error bars, raw timing data, or quantitative checks on field inhomogeneity or synchronization jitter, so it is impossible to judge whether the linearity is real or an artifact of the pulsed setup. Without those details the incompatibility claim with phase competition models stays untested.

This is for groups doing high-field x-ray work on cuprates or density-wave physics. A reader who wants to see the latest on accessing the normal state at extreme fields will find the approach useful if the methods section holds up.

It should go to peer review so the data quality and artifact controls can be examined properly.

Referee Report

3 major / 2 minor

Summary. The manuscript reports FEL x-ray diffraction measurements synchronized with pulsed magnetic fields up to 44 T on a cuprate superconductor. It claims a linear increase in charge-order amplitude and correlation length that persists well above the vortex-melting field, incompatible with conventional superconductivity–charge-order competition. Conventional hard x-ray diffraction and magnetostriction measurements show weaker field-induced monoclinic lattice distortions, interpreted as secondary. Combined with prior observations of field-linear spin freezing, the authors conclude a direct coupling of the magnetic field to the spin component of stripe order in the high-field normal state.

Significance. If the linear field dependence is intrinsic and free of pulsed-field artifacts, the work would establish a previously inaccessible direct magneto-stripe coupling mechanism independent of superconductivity suppression. This would have broad implications for the normal-state phase diagram of cuprates. The pulsed-field FEL synchronization technique itself constitutes a notable experimental advance for accessing high-field regimes in correlated-electron materials.

major comments (3)

[Experimental Approach] Experimental Approach paragraph: quantitative diagnostics for FEL-pulse timing jitter, magnetic-field homogeneity across the sample, and pulse-to-pulse intensity variations that could correlate with B are not reported. These are required to exclude systematic biases that could artificially produce the claimed linear rise in charge-order amplitude and correlation length.
[Results] Results section describing charge-order parameters: the linear fits to amplitude and correlation length versus B are presented without error bars, raw intensity profiles, or explicit discussion of systematic uncertainties from the pulsed environment. This omission directly affects the robustness of the incompatibility claim with standard phase-competition scenarios.
[Conventional Measurements] Section on conventional hard x-ray and magnetostriction measurements: no quantitative comparison of field scales, slopes, or error budgets is given between the pulsed FEL data and the conventional data. Without this, the assertion that the magnetoelastic response is weaker and merely an epiphenomenon remains unanchored.

minor comments (2)

[Abstract] The specific cuprate compound and doping level should be stated explicitly in the abstract for immediate context.
[Figures] Notation for charge-order wavevector and correlation length should be defined consistently between text and figures.

Simulated Author's Rebuttal

3 responses · 0 unresolved

We thank the referee for the careful and constructive review. The comments highlight important aspects of experimental validation and data presentation that strengthen the manuscript. We address each major comment below and have revised the manuscript to incorporate the requested details and comparisons.

read point-by-point responses

Referee: Experimental Approach paragraph: quantitative diagnostics for FEL-pulse timing jitter, magnetic-field homogeneity across the sample, and pulse-to-pulse intensity variations that could correlate with B are not reported. These are required to exclude systematic biases that could artificially produce the claimed linear rise in charge-order amplitude and correlation length.

Authors: We agree that explicit quantitative diagnostics are necessary to rule out artifacts. In the revised manuscript we have added a dedicated Methods subsection reporting: (i) direct measurements of FEL-pulse timing jitter (<50 fs rms), (ii) finite-element calculations of magnetic-field homogeneity (better than 0.1 % variation across the illuminated sample volume), and (iii) statistical analysis of pulse-to-pulse x-ray intensity fluctuations showing no statistically significant correlation with the applied field B. These additions confirm that the observed linear trends cannot be attributed to the identified systematic effects. revision: yes
Referee: Results section describing charge-order parameters: the linear fits to amplitude and correlation length versus B are presented without error bars, raw intensity profiles, or explicit discussion of systematic uncertainties from the pulsed environment. This omission directly affects the robustness of the incompatibility claim with standard phase-competition scenarios.

Authors: We have revised the Results section to include error bars on all extracted parameters (obtained from Lorentzian fits to the diffraction peaks, incorporating both statistical and background-subtraction uncertainties). Raw intensity profiles at representative fields are now shown in a new supplementary figure. We have also added an explicit paragraph discussing pulsed-environment systematics (field inhomogeneity, timing jitter, and intensity fluctuations) and demonstrate that their combined contribution is at least a factor of three smaller than the observed field-induced changes, thereby reinforcing the incompatibility with conventional phase-competition models. revision: yes
Referee: Section on conventional hard x-ray and magnetostriction measurements: no quantitative comparison of field scales, slopes, or error budgets is given between the pulsed FEL data and the conventional data. Without this, the assertion that the magnetoelastic response is weaker and merely an epiphenomenon remains unanchored.

Authors: We have inserted a new paragraph and accompanying table that directly compares the two datasets. The table lists the onset field, linear slope (normalized to the zero-field value), and estimated total uncertainty budget for both the FEL charge-order amplitude and the conventional magnetostriction/monoclinic distortion. The comparison shows that the magnetoelastic response is weaker by a factor of ~4 and saturates at lower fields (~25 T) than the charge-order enhancement, supporting the interpretation that the lattice distortion is a secondary consequence rather than the driver of the observed stripe-order increase. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity; purely observational study

full rationale

The manuscript reports direct experimental measurements of charge-order amplitude and correlation length under pulsed magnetic fields using synchronized FEL x-rays, supplemented by conventional diffraction and magnetostriction data. No equations, fitted parameters, or model derivations are presented that reduce to their own inputs by construction. The central inference of direct field-spin-stripe coupling is drawn from the observed linear field dependence (persisting above vortex melting) combined with independent prior observations of spin freezing; this is empirical interpretation rather than a self-referential chain. No self-citation load-bearing steps, ansatzes, or renamings of known results appear in the derivation. The work is self-contained against external benchmarks as an observational report.

Assumptions & free parameters 0 free parameters · 1 assumptions · 0 invented entities

The central claim rests on the assumption that the x-ray diffraction signal under pulsed high fields accurately reflects intrinsic stripe order without significant systematic artifacts from the experimental setup.

assumptions (1)

domain assumption Standard x-ray diffraction analysis applies without modification under synchronized pulsed high-magnetic-field conditions
Invoked when interpreting the linear increase in charge order amplitude and correlation length from the FEL data.

how reviews work

0 comments

Cite this review

Pith. "Pith review of Direct High-Magnetic-Field Coupling to Stripe Order in a Cuprate Superconductor." pith.science (2026). https://pith.science/paper/MRCTWRNM

@misc{pith2026260607349,
  author       = {Pith},
  title        = {Pith review of: Direct High-Magnetic-Field Coupling to Stripe Order in a Cuprate Superconductor},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/MRCTWRNM}},
  note         = {Machine review of arXiv:2606.07349}
}

read the original abstract

Superconductivity in cuprates emerges out of a complex normal state that hosts density waves, pseudogap physics, and strange metal properties. Here, we access this normal state by synchronizing free-electron laser x-rays with high-magnetic-field pulses up to 44 T. We observe a linear increase in charge order amplitude and correlation length that persists far above the vortex melting transition. This behavior is incompatible with standard phase competition between charge order and superconductivity. By means of conventional hard x-ray diffraction and magnetostriction, we show that applied fields also enhance monoclinic lattice distortions. However, this magnetoelastic response is weaker and an epiphenomenon of the stripe order enhancement. Combined with recent observations of field-linear spin freezing, our results point to a direct coupling between magnetic field and the spin component of stripe order in the high-field normal state -- a mechanism independent of superconductivity suppression that has so far remained hidden from scattering probes.

Figures

Figures reproduced from arXiv: 2606.07349 by the authors.

**Figure 2.** FIG. 2 [PITH_FULL_IMAGE:figures/full_fig_p003_2.png] view at source ↗

**Figure 3.** FIG. 3 [PITH_FULL_IMAGE:figures/full_fig_p004_3.png] view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

293 extracted references · 259 canonical work pages

[1]

Physical Review B , author =

O 17. Physical Review B , author =. 2005 , pages =. doi:10.1103/PhysRevB.72.014537 , language =

work page doi:10.1103/physrevb.72.014537 2005
[2]

Wu , author H

Emergence of charge order from the vortex state of a high-temperature superconductor , volume =. Nature Communications , author =. 2013 , keywords =. doi:10.1038/ncomms3113 , abstract =

work page doi:10.1038/ncomms3113 2013
[3]

Girod, D

Normal state specific heat in the cuprate superconductors. Physical Review B , author =. 2021 , pages =. doi:10.1103/PhysRevB.103.214506 , language =

work page doi:10.1103/physrevb.103.214506 2021
[4]

Image quality assessment: From error visibility to structural similarity.Image Processing, IEEE Transactions on, 13:600 – 612, 05 2004

Image quality assessment: from error visibility to structural similarity , volume =. IEEE Transactions on Image Processing , author =. 2004 , pages =. doi:10.1109/TIP.2003.819861 , number =

work page doi:10.1109/tip.2003.819861 2004
[5]

Proceedings of the 33rd

Paszke, Adam and Gross, Sam and Massa, Francisco and Lerer, Adam and Bradbury, James and Chanan, Gregory and Killeen, Trevor and Lin, Zeming and Gimelshein, Natalia and Antiga, Luca and Desmaison, Alban and Köpf, Andreas and Yang, Edward and DeVito, Zach and Raison, Martin and Tejani, Alykhan and Chilamkurthy, Sasank and Steiner, Benoit and Fang, Lu and B...
[6]

MarketsandMarkets , note =

Cryo-electron. MarketsandMarkets , note =
[7]

Physical Review B , author =

Existence of electron and hole pockets and partial gap opening in the correlated semimetal. Physical Review B , author =. 2018 , pages =. doi:10.1103/PhysRevB.97.041113 , language =

work page doi:10.1103/physrevb.97.041113 2018
[8]

Radiation Measurements , author =

An introduction to the. Radiation Measurements , author =. 2020 , keywords =. doi:10.1016/j.radmeas.2020.106271 , abstract =

work page doi:10.1016/j.radmeas.2020.106271 2020

Show all 293 references

[9]

and Gerguri, O

Biało, I. and Gerguri, O. and Martinelli, L. and Küspert, J. and Choi, J. and Garcia-Fernandez, M. and Agrestini, S. and Zhou, K. J. and Weschke, E. and Kurosawa, T. and Momono, N. and Oda, M. and Lin, C. and Wang, Q. and Chang, J. , month = jan, year =. Orbital. doi:10.48550/...

doi
[10]

and Kuo, C.-T

Lee, H. and Kuo, C.-T. and Fujita, M. and Kao, C.-C. and Lee, J.-S. , month = may, year =. Superconductivity. Physical Review Letters , publisher =. doi:10.1103/g41t-8456 , abstract =

doi
[11]

Neural Networks , author =

Deep learning on image denoising:. Neural Networks , author =. 2020 , pages =. doi:10.1016/j.neunet.2020.07.025 , language =

2020 doi
[12]

Communications Biology , author =

Content aware image restoration improves spatiotemporal resolution in luminescence imaging , volume =. Communications Biology , author =. 2023 , pages =. doi:10.1038/s42003-023-04886-z , abstract =

2023 doi
[13]

Nature Communications , author =

Democratising deep learning for microscopy with. Nature Communications , author =. 2021 , pages =. doi:10.1038/s41467-021-22518-0 , abstract =

2021 doi
[14]

Electronic Structure , author =

Line shapes in time- and angle-resolved photoemission spectroscopy explored by machine learning , volume =. Electronic Structure , author =. 2025 , pages =. doi:10.1088/2516-1075/ae1e4a , abstract =

2025 doi
[15]

Physical Review Materials , author =

Denoising scanning tunneling microscopy images of graphene with supervised machine learning , volume =. Physical Review Materials , author =. 2022 , pages =. doi:10.1103/PhysRevMaterials.6.123802 , language =

2022 doi
[16]

Buchholz, Tim-Oliver and Jordan, Mareike and Pigino, Gaia and Jug, Florian , month = apr, year =. Cryo-. 2019. doi:10.1109/ISBI.2019.8759519 , urldate =

2019 doi
[17]

2026 , keywords =

Expert Systems with Applications , author =. 2026 , keywords =. doi:10.1016/j.eswa.2025.129126 , abstract =

2026 doi
[18]

Probabilistic denoising for reliable signal extraction in spectroscopy , copyright =

Kim, Younsik and Kim, Changyoung , year =. Probabilistic denoising for reliable signal extraction in spectroscopy , copyright =. doi:10.48550/ARXIV.2605.07819 , abstract =

doi arXiv
[19]

IEEE Signal Processing Letters , author =

On. IEEE Signal Processing Letters , author =. 2020 , pages =. doi:10.1109/LSP.2020.3016837 , urldate =

2020 doi
[20]

Ultramicroscopy , author =

Comparison of optimal performance at 300. Ultramicroscopy , author =. 2014 , keywords =. doi:10.1016/j.ultramic.2014.08.002 , abstract =

2014 doi
[21]

Ultramicroscopy , author =

Sub-pixel electron detection using a convolutional neural network , volume =. Ultramicroscopy , author =. 2020 , keywords =. doi:10.1016/j.ultramic.2020.113091 , abstract =

2020 doi
[22]

and Šišak Jung, D

Donath, T. and Šišak Jung, D. and Burian, M. and Radicci, V. and Zambon, P. and Fitch, A. N. and Dejoie, C. and Zhang, B. and Ruat, M. and Hanfland, M. and Kewish, C. M. and Riessen, G. A. van and Naumenko, D. and Amenitsch, H. and Bourenkov, G. and Bricogne, G. and Chari, A. ...

doi
[23]

and Dudina, Alexandra and Kaspar, Sebastian and Schulze-Briese, Clemens , month = feb, year =

Zambon, Pietro and Montemurro, Giuseppe Vito and Fernandez-Perez, Sonia and Schnyder, Roger and Lehmann, Niklaus and Sakhelashvili, Tariel and Burkhalter, Stephan and Meffert, Matthias and Jensen, Arne and Würsch, Pascal and Jud, Pascal A. and Dudina, Alexandra and Kaspar, Seb...

doi
[24]

and Barba Flores, L

Xie, X. and Barba Flores, L. and Bejar Haro, B. and Bergamaschi, A. and Fröjdh, E. and Müller, E. and Paton, K.A. and Poghosyan, E. and Remlinger, C. , month = jan, year =. Enhancing spatial resolution in. Journal of Instrumentation , publisher =. doi:10.1088/1748-0221/19/01/C...

doi
[25]

Journal of Instrumentation , author =

M. Journal of Instrumentation , author =. 2014 , pages =. doi:10.1088/1748-0221/9/05/C05015 , abstract =

2014 doi
[26]

Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment , author =

Allpix2:. Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment , author =. 2018 , keywords =. doi:10.1016/j.nima.2018.06.020 , abstract =

2018 doi
[27]

Machine Learning: Science and Technology , author =

An autoencoder for compressing angle-resolved photoemission spectroscopy data , volume =. Machine Learning: Science and Technology , author =. 2025 , pages =. doi:10.1088/2632-2153/ada8f2 , abstract =

2025 doi
[29]

Physical Review X , author =

Fisher. Physical Review X , author =. 2025 , pages =. doi:10.1103/kn3z-rmm8 , abstract =

2025 doi
[30]

Journal of Instrumentation , author =

A. Journal of Instrumentation , author =. 2014 , pages =. doi:10.1088/1748-0221/9/12/C12018 , abstract =

2014 doi
[31]

and Kelman, Bradley and Pichon, Thibault and Biancalani, Enrico and Gilbert, James , month = dec, year =

Arko, Matej and Prod’homme, Thibaut and Lemmel, Frederic and Serra, Benoit and George, Elizabeth M. and Kelman, Bradley and Pichon, Thibault and Biancalani, Enrico and Gilbert, James , month = dec, year =. Pyxel 1.0: an open source. Journal of Astronomical Telescopes, Instrume...

doi
[32]

Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment , author =

Geant4—a simulation toolkit , volume =. Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment , author =. 2003 , keywords =. doi:10.1016/S0168-9002(03)01368-8 , abstract =

2003 doi
[33]

Proceedings of the National Academy of Sciences , author =

Superconductivity suppression and bilayer decoupling in. Proceedings of the National Academy of Sciences , author =. 2026 , pages =. doi:10.1073/pnas.2536919123 , abstract =

2026 doi
[34]

2009 , pages =

The Astrophysical Journal , author =. 2009 , pages =. doi:10.1088/0004-637X/702/2/970 , number =

2009 doi
[35]

Physical Review B , author =

Orbital magnetic moments in. Physical Review B , author =. 2025 , pages =. doi:10.1103/hdzg-mn6r , language =

2025 doi
[36]

Astronomy & Astrophysics , author =

Investigating the interstellar dust through the. Astronomy & Astrophysics , author =. 2018 , pages =. doi:10.1051/0004-6361/201731664 , abstract =

2018 doi
[37]

Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment , author =

Laue diffraction from biological samples , volume =. Nuclear Instruments and Methods in Physics Research Section A: Accelerators, Spectrometers, Detectors and Associated Equipment , author =. 1986 , pages =. doi:10.1016/0168-9002(86)90164-6 , abstract =

1986 doi
[38]

Current Opinion in Structural Biology , author =

Radiation damage to biological macromolecules∗ , volume =. Current Opinion in Structural Biology , author =. 2023 , keywords =. doi:10.1016/j.sbi.2023.102662 , abstract =

2023 doi
[39]

Native structure of photosystem

Suga, Michihiro and Akita, Fusamichi and Hirata, Kunio and Ueno, Go and Murakami, Hironori and Nakajima, Yoshiki and Shimizu, Tetsuya and Yamashita, Keitaro and Yamamoto, Masaki and Ago, Hideo and Shen, Jian-Ren , month = jan, year =. Native structure of photosystem. Nature , ...

doi
[40]

The Journal of Physical Chemistry C , author =

Quantitative. The Journal of Physical Chemistry C , author =. 2017 , pages =. doi:10.1021/acs.jpcc.7b01749 , abstract =

2017 doi
[41]

Garman, E. F. and Weik, M. , month = sep, year =. Radiation damage to biological samples: still a pertinent issue , volume =. Journal of Synchrotron Radiation , publisher =. doi:10.1107/S1600577521008845 , abstract =

doi
[42]

Nature Communications , author =

Two-dimensional bilayer ice in coexistence with three-dimensional ice without confinement , volume =. Nature Communications , author =. 2024 , pages =. doi:10.1038/s41467-024-50187-2 , abstract =

2024 doi
[43]

, year =

Walet, Niels R. , year =. Water confined between graphene layers: the case for a square ice , copyright =. doi:10.48550/ARXIV.1702.00963 , abstract =

doi arXiv
[44]

Nature , author =

Square ice in graphene nanocapillaries , volume =. Nature , author =. 2015 , pages =. doi:10.1038/nature14295 , language =

2015 doi
[45]

Journal of Alloys and Compounds , author =

Characteristic. Journal of Alloys and Compounds , author =. 2016 , pages =. doi:10.1016/j.jallcom.2015.08.193 , language =

2016 doi
[46]

Physical Review Letters , author =

Scaling of. Physical Review Letters , author =. 1998 , pages =. doi:10.1103/PhysRevLett.80.5623 , language =

1998 doi
[47]

npj Quantum Materials , author =

Multicomponent fluctuation spectrum at the quantum critical point in. npj Quantum Materials , author =. 2019 , pages =. doi:10.1038/s41535-019-0191-y , abstract =

2019 doi
[48]

Nature Physics , author =

Charge-order-maximized momentum-dependent superconductivity , volume =. Nature Physics , author =. 2007 , pages =. doi:10.1038/nphys699 , language =

2007 doi
[49]

Physical Review Letters , author =

Dimerization-. Physical Review Letters , author =. 2014 , pages =. doi:10.1103/PhysRevLett.112.086402 , language =

2014 doi
[50]

Scientific Reports , author =

Charge-. Scientific Reports , author =. 2017 , pages =. doi:10.1038/s41598-017-16945-7 , abstract =

2017 doi
[51]

Science Advances , author =

Resonant inelastic x-ray incarnation of. Science Advances , author =. 2019 , pages =. doi:10.1126/sciadv.aav4020 , abstract =

2019 doi
[52]

Reviews of Modern Physics , author =

Spin-density-wave antiferromagnetism in chromium , volume =. Reviews of Modern Physics , author =. 1988 , pages =. doi:10.1103/RevModPhys.60.209 , language =

1988 doi
[53]

Nature Physics , author =

Spatially modulated '. Nature Physics , author =. 2005 , pages =. doi:10.1038/nphys178 , language =

2005 doi
[54]

Physical Review B , author =

Anomalous. Physical Review B , author =. 2021 , pages =. doi:10.1103/PhysRevB.103.L020405 , language =

2021 doi
[55]

Journal of Synchrotron Radiation , author =

P21.1 at. Journal of Synchrotron Radiation , author =. 2025 , pages =. doi:10.1107/S1600577525002826 , abstract =

2025 doi
[56]

Journal of the Physical Society of Japan , author =

Lattice. Journal of the Physical Society of Japan , author =. 2019 , pages =. doi:10.7566/JPSJ.88.014602 , language =

2019 doi
[57]

Physical Review Materials , author =

Insensitivity of the striped charge orders in. Physical Review Materials , author =. 2021 , pages =. doi:10.1103/PhysRevMaterials.5.074002 , language =

2021 doi
[58]

Nature Nanotechnology , author =

Strongly enhanced charge-density-wave order in monolayer. Nature Nanotechnology , author =. 2015 , pages =. doi:10.1038/nnano.2015.143 , language =

2015 doi
[59]

Communications Materials , author =

Charge density waves and the effects of uniaxial strain on the electronic structure of. Communications Materials , author =. 2024 , pages =. doi:10.1038/s43246-024-00661-7 , language =

2024 doi
[60]

Nature , author =

Discovery of charge density wave in a kagome lattice antiferromagnet , volume =. Nature , author =. 2022 , pages =. doi:10.1038/s41586-022-05034-z , language =

2022 doi
[61]

Nature Communications , author =

Square and rhombic lattices of magnetic skyrmions in a centrosymmetric binary compound , volume =. Nature Communications , author =. 2022 , pages =. doi:10.1038/s41467-022-29131-9 , abstract =

2022 doi
[62]

Physical Review B , author =

Correlation between complex spin textures and the magnetocaloric and. Physical Review B , author =. 2025 , pages =. doi:10.1103/PhysRevB.111.165136 , language =

2025 doi
[63]

Physical Review B , author =

Spin order and fluctuations in the. Physical Review B , author =. 2022 , pages =. doi:10.1103/PhysRevB.105.014423 , language =

2022 doi
[64]

Journal of the Physical Society of Japan , author =

Transport and. Journal of the Physical Society of Japan , author =. 2015 , pages =. doi:10.7566/JPSJ.84.124711 , language =

2015 doi
[65]

Physical Review B , author =

Electron-phonon coupling in. Physical Review B , author =. 2025 , pages =. doi:10.1103/PhysRevB.111.195150 , language =

2025 doi
[66]

Physical Review B , author =

Phonon softening and atomic modulations in. Physical Review B , author =. 2024 , pages =. doi:10.1103/PhysRevB.110.045102 , abstract =

2024 doi
[67]

Communications Physics , author =

Origin of charge density wave in topological semimetals. Communications Physics , author =. 2024 , pages =. doi:10.1038/s42005-024-01600-1 , abstract =

2024 doi
[68]

Physical Review B , author =

Band structure and charge ordering of. Physical Review B , author =. 2024 , pages =. doi:10.1103/PhysRevB.110.125150 , language =

2024 doi
[69]

Nature , author =

Formation of isomorphic. Nature , author =. 2002 , pages =. doi:10.1038/416155a , language =

2002 doi
[70]

Nature Communications , author =

Large-gap insulating dimer ground state in monolayer. Nature Communications , author =. 2022 , pages =. doi:10.1038/s41467-022-28542-y , abstract =

2022 doi
[71]

Physical Review B , author =

Charge ordering in. Physical Review B , author =. 2022 , pages =. doi:10.1103/PhysRevB.105.075114 , language =

2022 doi
[72]

2023 , pages =

Physical Review Research , author =. 2023 , pages =. doi:10.1103/PhysRevResearch.5.013167 , language =

2023 doi
[73]

Proceedings of the National Academy of Sciences , author =

Classification of charge density waves based on their nature , volume =. Proceedings of the National Academy of Sciences , author =. 2015 , pages =. doi:10.1073/pnas.1424791112 , abstract =

2015 doi
[74]

Advances in Physics , author =

Electronic crystals: an experimental overview , volume =. Advances in Physics , author =. 2012 , pages =. doi:10.1080/00018732.2012.719674 , language =

2012 doi
[75]

Physical Review Research , author =

Noncentrosymmetric, transverse structural modulation in. Physical Review Research , author =. 2024 , pages =. doi:10.1103/PhysRevResearch.6.023277 , abstract =

2024 doi
[76]

Physical Review B , author =

Broken inversion symmetry in the charge density wave phase in. Physical Review B , author =. 2025 , pages =. doi:10.1103/kl2z-brms , abstract =

2025 doi
[77]

Nature Communications , author =

Origin of multiple skyrmion phases in. Nature Communications , author =. 2026 , pages =. doi:10.1038/s41467-026-71020-y , language =

2026 doi
[78]

and Hüvonen, D

Yankova, T. and Hüvonen, D. and Mühlbauer, S. and Schmidiger, D. and Wulf, E. and Zhao, S. and Zheludev, A. and Hong, T. and Garlea, V.O. and Custelcean, R. and Ehlers, G. , month = jul, year =. Crystals for neutron scattering studies of quantum magnetism , volume =. Philosoph...

2012 doi
[79]

Candidate quantum spin ice in the pyrochlore \ \

Sibille, Romain and Lhotel, Elsa and Hatnean, Monica Ciomaga and Balakrishnan, Geetha and Fåk, Björn and Gauthier, Nicolas and Fennell, Tom and Kenzelmann, Michel , month = jul, year =. Candidate quantum spin ice in the pyrochlore \ \. Physical Review B , publisher =. doi:10.1...

doi
[80]

Journal of Applied Crystallography , author =

Alignment facility and software for single-crystal time-of-flight neutron spectroscopy , volume =. Journal of Applied Crystallography , author =. 2021 , pages =. doi:10.1107/S1600576721004234 , abstract =

2021 doi
[81]

and Fobes, D

Weber, T. and Fobes, D. M. and Waizner, J. and Steffens, P. and Tucker, G. S. and Böhm, M. and Beddrich, L. and Franz, C. and Gabold, H. and Bewley, R. and Voneshen, D. and Skoulatos, M. and Georgii, R. and Ehlers, G. and Bauer, A. and Pfleiderer, C. and Böni, P. and Janoschek...

doi
[82]

Nature , author =

High-temperature superconductivity in monolayer. Nature , author =. 2019 , pages =. doi:10.1038/s41586-019-1718-x , language =

2019 doi
[83]

Physical Review Letters , author =

Superconductor-. Physical Review Letters , author =. 2012 , pages =. doi:10.1103/PhysRevLett.108.257003 , language =

2012 doi
[84]

Reports on Progress in Physics , author =

Quantum phase transitions in two-dimensional superconductors: a review on recent experimental progress , volume =. Reports on Progress in Physics , author =. 2024 , pages =. doi:10.1088/1361-6633/ad14f3 , abstract =

2024 doi
[85]

Advanced Energy Materials , author =

Effects of. Advanced Energy Materials , author =. 2025 , pages =. doi:10.1002/aenm.202500758 , abstract =

2025 doi
[86]

Nature Communications , author =

Origin of apparent light-enhanced and negative capacitance in perovskite solar cells , volume =. Nature Communications , author =. 2019 , pages =. doi:10.1038/s41467-019-09079-z , abstract =

2019 doi
[87]

Nielsen, Frank , editor =. Cramér-. Connected at. 2013 , note =. doi:10.1007/978-93-86279-56-9_2 , urldate =

2013 doi
[88]

Nature Communications , author =

Quantum criticality at the superconductor-insulator transition revealed by specific heat measurements , volume =. Nature Communications , author =. 2017 , pages =. doi:10.1038/ncomms14464 , abstract =

2017 doi
[89]

Proceedings of the National Academy of Sciences , author =

Superconductor–insulator transition in two-dimensional indium–indium-oxide composite , volume =. Proceedings of the National Academy of Sciences , author =. 2021 , pages =. doi:10.1073/pnas.2015970118 , abstract =

2021 doi
[90]

and Legant, Wesley R

Speiser, Artur and Müller, Lucas-Raphael and Hoess, Philipp and Matti, Ulf and Obara, Christopher J. and Legant, Wesley R. and Kreshuk, Anna and Macke, Jakob H. and Ries, Jonas and Turaga, Srinivas C. , month = sep, year =. Deep learning enables fast and dense single-molecule ...

doi
[91]

Restormer:

Zamir, Syed Waqas and Arora, Aditya and Khan, Salman and Hayat, Munawar and Khan, Fahad Shahbaz and Yang, Ming-Hsuan , year =. Restormer:
[92]

Liu, Ze and Lin, Yutong and Cao, Yue and Hu, Han and Wei, Yixuan and Zhang, Zheng and Lin, Stephen and Guo, Baining , year =. Swin
[93]

Journal of Open Source Software , author =

Visualization of. Journal of Open Source Software , author =. 2021 , pages =. doi:10.21105/joss.02969 , number =

2021 doi
[94]

2025 , pages =

Journal of Open Source Software , author =. 2025 , pages =. doi:10.21105/joss.09129 , number =

2025 doi
[95]

and Becker, J

Allahgholi, A. and Becker, J. and Delfs, A. and Dinapoli, R. and Goettlicher, P. and Greiffenberg, D. and Henrich, B. and Hirsemann, H. and Kuhn, M. and Klanner, R. and Klyuev, A. and Krueger, H. and Lange, S. and Laurus, T. and Marras, A. and Mezza, D. and Mozzanica, A. and N...

doi
[96]

and Appel, K

Zastrau, U. and Appel, K. and Baehtz, C. and Baehr, O. and Batchelor, L. and Berghäuser, A. and Banjafar, M. and Brambrink, E. and Cerantola, V. and Cowan, T. E. and Damker, H. and Dietrich, S. and Di Dio Cafiso, S. and Dreyer, J. and Engel, H.-O. and Feldmann, T. and Findeise...

doi
[97]

Intertwining electronic and spin order in superconducting cuprates and magnetoelectric materials , url =

Yamamoto, Shingo , year =. Intertwining electronic and spin order in superconducting cuprates and magnetoelectric materials , url =. doi:10.22003/XFEL.EU-DATA-006776-00 , urldate =

doi
[98]

2025 , pages =

Superconductor Science and Technology , author =. 2025 , pages =. doi:10.1088/1361-6668/ada9d2 , abstract =

2025 doi
[99]

and Hussey, Nigel E

Phillips, Philip W. and Hussey, Nigel E. and Abbamonte, Peter , month = jul, year =. Stranger than metals , volume =. Science , publisher =. doi:10.1126/science.abh4273 , abstract =

doi
[100]

Science , author =

Direct determination of mode-projected electron-phonon coupling in the time domain , volume =. Science , author =. 2019 , pages =. doi:10.1126/science.aaw1662 , abstract =

2019 doi
[101]

Science , author =

Rapid change of superconductivity and electron-phonon coupling through critical doping in. Science , author =. 2018 , pages =. doi:10.1126/science.aar3394 , abstract =

2018 doi
[102]

Nature Computational Science , author =

Accelerating the calculation of electron–phonon coupling strength with machine learning , volume =. Nature Computational Science , author =. 2024 , pages =. doi:10.1038/s43588-024-00668-7 , language =

2024 doi
[104]

Physical Review B , author =

Tuning incommensurate charge order in. Physical Review B , author =. 2025 , pages =. doi:10.1103/d8yy-1w3l , language =

2025 doi
[105]

Science Advances , author =

The importance of shear on the collective charge transport in. Science Advances , author =. 2025 , pages =. doi:10.1126/sciadv.adr6034 , abstract =

2025 doi
[106]

Physical Review B , author =

Generalization of the. Physical Review B , author =. 2020 , pages =. doi:10.1103/PhysRevB.101.214307 , language =

2020 doi
[108]

npj Quantum Materials , author =

Strong coupling theory of superconductivity and ferroelectric quantum criticality in metallic. npj Quantum Materials , author =. 2025 , pages =. doi:10.1038/s41535-025-00798-9 , language =

2025 doi
[109]

Physical Review Letters , author =

Large. Physical Review Letters , author =. 2020 , pages =. doi:10.1103/PhysRevLett.125.126401 , language =

2020 doi
[110]

Physical Review B , author =

Bare electron dispersion from experiment:. Physical Review B , author =. 2005 , pages =. doi:10.1103/PhysRevB.71.214513 , language =

2005 doi
[112]

Physical Review Letters , author =

Experimental. Physical Review Letters , author =. 2019 , pages =. doi:10.1103/PhysRevLett.123.027001 , language =

2019 doi
[113]

Review of Scientific Instruments , author =

High resolution magnetostriction measurements in pulsed magnetic fields using fiber. Review of Scientific Instruments , author =. 2010 , pages =. doi:10.1063/1.3356980 , abstract =

2010 doi
[114]

Physical Review Letters , author =

X-. Physical Review Letters , author =. 2025 , pages =. doi:10.1103/r7br-qnrn , abstract =

2025 doi
[115]

and Stifter, M

Oppliger, J. and Stifter, M. and Rüegg, A. and Biało, I. and Martinelli, L. and Freeman, P. G. and Prabhakaran, D. and Zhao, J. and Wang, Q. and Chang, J. , month = apr, year =. Autonomous. doi:10.48550/arXiv.2604.11773 , abstract =

doi arXiv
[116]

Zeitschrift für Physik B Condensed Matter , author =

Possible. Zeitschrift für Physik B Condensed Matter , author =. 1986 , keywords =. doi:10.1007/BF01303701 , abstract =

1986 doi
[117]

Materials Research Bulletin , author =

Li _. Materials Research Bulletin , author =. 1980 , pages =. doi:10.1016/0025-5408(80)90012-4 , abstract =

1980 doi
[118]

and Pan, C

Wang, Z. and Pan, C. and Yu, L. and He, B. and Su, Z. and Zhang, W. and Wang, S. and Sun, B. and Wen, W. and Gao, X. and Hao, Q. , month = aug, year =. Laueprocess: a software package for processing. Journal of Applied Crystallography , publisher =. doi:10.1107/S16005767250050...

doi
[119]

Improving

Yarats, Denis and Zhang, Amy and Kostrikov, Ilya and Amos, Brandon and Pineau, Joelle and Fergus, Rob , month = may, year =. Improving. Proceedings of the. doi:10.1609/aaai.v35i12.17276 , abstract =

doi
[120]

Advanced Undergraduate Laborary: Laue Back-Reflection of X-rays , author =

Advanced. Advanced Undergraduate Laborary: Laue Back-Reflection of X-rays , author =. 2016 , note =

2016
[121]

and Hunt, Jonathan J

Lillicrap, Timothy P. and Hunt, Jonathan J. and Pritzel, Alexander and Heess, Nicolas and Erez, Tom and Tassa, Yuval and Silver, David and Wierstra, Daan , month = sep, year =. Continuous control with deep reinforcement learning , url =
[122]

Deterministic

Silver, David and Lever, Guy and Heess, Nicolas and Degris, Thomas and Wierstra, Daan and Riedmiller, Martin , month = jan, year =. Deterministic. Proceedings of the 31st
[123]

Physical Review Letters , author =

Exploring the. Physical Review Letters , author =. 2010 , pages =. doi:10.1103/PhysRevLett.105.187001 , language =

2010 doi
[124]

Nature Communications , author =

Robust upward dispersion of the neutron spin resonance in the heavy fermion superconductor. Nature Communications , author =. 2016 , pages =. doi:10.1038/ncomms12774 , abstract =

2016 doi
[125]

Physical Review Letters , author =

From. Physical Review Letters , author =. 2018 , pages =. doi:10.1103/PhysRevLett.121.037003 , number =

2018 doi
[126]

Yarats, Denis and Kostrikov, Ilya and Fergus, Rob , month = oct, year =. Image. International
[127]

Mastering

Yarats, Denis and Fergus, Rob and Lazaric, Alessandro and Pinto, Lerrel , month = dec, year =. Mastering. Deep
[128]

and Roberts, Stephen and Celiktutan, Oya , month = jun, year =

Cetin, Edoardo and Ball, Philip J. and Roberts, Stephen and Celiktutan, Oya , month = jun, year =. Stabilizing. Proceedings of the 39th
[129]

Physical Review B , author =

Disorder-induced broadening of the spin waves in the triangular-lattice quantum spin liquid candidate. Physical Review B , author =. 2021 , pages =. doi:10.1103/PhysRevB.104.224433 , number =

2021 doi
[130]

Physical Review B , author =

Two-dimensional ferromagnetic spin-orbital excitations in honeycomb. Physical Review B , author =. 2021 , pages =. doi:10.1103/PhysRevB.104.L020411 , number =

2021 doi
[131]

Physical Review Letters , author =

Spin. Physical Review Letters , author =. 2019 , pages =. doi:10.1103/PhysRevLett.122.047004 , language =

2019 doi
[132]

Physical Review Letters , author =

Spin. Physical Review Letters , author =. 2008 , pages =. doi:10.1103/PhysRevLett.100.087001 , number =

2008 doi
[133]

Communications Physics , author =

Spontaneous reversal of spin chirality and competing phases in the topological magnet. Communications Physics , author =. 2024 , pages =. doi:10.1038/s42005-024-01802-7 , abstract =

2024 doi
[134]

Nature Communications , author =

A microscopic. Nature Communications , author =. 2023 , pages =. doi:10.1038/s41467-023-43947-z , abstract =

2023 doi
[135]

Reinforcement learning with augmented data , isbn =

Laskin, Michael and Lee, Kimin and Stooke, Adam and Pinto, Lerrel and Abbeel, Pieter and Srinivas, Aravind , month = dec, year =. Reinforcement learning with augmented data , isbn =. Proceedings of the 34th
[136]

Haarnoja, Tuomas and Zhou, Aurick and Abbeel, Pieter and Levine, Sergey , month = jul, year =. Soft. Proceedings of the 35th
[137]

Haarnoja, Tuomas and Zhou, Aurick and Hartikainen, Kristian and Tucker, George and Ha, Sehoon and Tan, Jie and Kumar, Vikash and Zhu, Henry and Gupta, Abhishek and Abbeel, Pieter and Levine, Sergey , month = jan, year =. Soft. doi:10.48550/arXiv.1812.05905 , abstract =

doi arXiv
[138]

Nature , author =

Evidence for a spinon. Nature , author =. 2016 , pages =. doi:10.1038/nature20614 , number =

2016 doi
[139]

Physical Review B , author =

Excitations in a quantum spin liquid with random bonds , volume =. Physical Review B , author =. 2012 , pages =. doi:10.1103/PhysRevB.86.214408 , number =

2012 doi
[140]

Physical Review Letters , author =

Extended. Physical Review Letters , author =. 2003 , pages =. doi:10.1103/PhysRevLett.91.037205 , number =

2003 doi
[141]

Curriculum learning for reinforcement learning domains: a framework and survey , volume =. J. Mach. Learn. Res. , author =. 2020 , pages =

2020
[142]

Sokar, Ghada and Agarwal, Rishabh and Castro, Pablo Samuel and Evci, Utku , month = jul, year =. The. Proceedings of the 40th
[143]

2022 , pages =

Journal of Applied Crystallography , author =. 2022 , pages =. doi:10.1107/S1600576722004198 , abstract =

2022 doi
[144]

Huang, V. W. and Liu, Y. and Raghothamachar, B. and Dudley, M. , month = oct, year =. Upgraded. Journal of Applied Crystallography , publisher =. doi:10.1107/S1600576723007926 , abstract =

doi
[145]

Science , author =

Coupled. Science , author =. 2008 , pages =. doi:10.1126/science.1161818 , abstract =

2008 doi
[146]

JOM , author =

Principles of. JOM , author =. 1952 , pages =. doi:10.1007/BF03398137 , abstract =

1952 doi
[147]

Nature Communications , author =

An. Nature Communications , author =. 2023 , pages =. doi:10.1038/s41467-023-40759-z , abstract =

2023 doi
[148]

Communications Physics , author =

Resolving the orbital character of low-energy excitations in. Communications Physics , author =. 2025 , pages =. doi:10.1038/s42005-025-02104-2 , abstract =

2025 doi
[149]

Science , author =

Ultrafast studies of elusive chemical reactions in the gas phase , volume =. Science , author =. 2024 , pages =. doi:10.1126/science.adk1833 , abstract =

2024 doi
[150]

Reviews of Modern Physics , author =

Vortices in high-temperature superconductors , volume =. Reviews of Modern Physics , author =. 1994 , pages =. doi:10.1103/RevModPhys.66.1125 , number =

1994 doi
[151]

and Aubin, H

Pourret, A. and Aubin, H. and Lesueur, J. and Marrache-Kikuchi, C. A. and Bergé, L. and Dumoulin, L. and Behnia, K. , month = oct, year =. Observation of the. Nature Physics , publisher =. doi:10.1038/nphys413 , abstract =

doi
[152]

Physical Review B , author =

Length scale for the superconducting. Physical Review B , author =. 2007 , pages =. doi:10.1103/PhysRevB.76.214504 , number =

2007 doi
[153]

Europhysics Letters , author =

Doping dependence of the upper critical field in. Europhysics Letters , author =. 2008 , pages =. doi:10.1209/0295-5075/81/57007 , abstract =

2008 doi
[154]

Acta Crystallographica Section A Foundations and Advances , author =

A cloud platform for atomic pair distribution function analysis:. Acta Crystallographica Section A Foundations and Advances , author =. 2021 , pages =. doi:10.1107/S2053273320013066 , abstract =

2021 doi
[155]

2013 , pages =

Journal of Applied Crystallography , author =. 2013 , pages =. doi:10.1107/S0021889813013113 , abstract =

2013 doi
[156]

Acta Crystallographica Section B Structural Science , author =

Structures of four polymorphs of the pesticide dithianon solved from. Acta Crystallographica Section B Structural Science , author =. 2012 , pages =. doi:10.1107/S0108768112036191 , abstract =

2012 doi
[157]

Microporous and Mesoporous Materials , author =

Synthesis and structure analysis of the layer silicate. Microporous and Mesoporous Materials , author =. 2007 , pages =. doi:10.1016/j.micromeso.2007.05.021 , language =

2007 doi
[158]

Acta Crystallographica Section E Structure Reports Online , author =

Powder study of (. Acta Crystallographica Section E Structure Reports Online , author =. 2007 , pages =. doi:10.1107/S1600536806052093 , number =

2007 doi
[159]

Acta Crystallographica Section B Structural Science , author =

Temperature effects on the hydrogen-bond patterns in 4-piperidinecarboxylic acid , volume =. Acta Crystallographica Section B Structural Science , author =. 2005 , pages =. doi:10.1107/S0108768104031738 , abstract =

2005 doi
[160]

New Journal of Chemistry , author =

Structure solution and refinement of tetracaine hydrochloride from. New Journal of Chemistry , author =. 2002 , pages =. doi:10.1039/b109494g , number =

2002 doi
[161]

Journal of Applied Crystallography , author =

Ab initio structure determination from severely overlapping powder diffraction data , volume =. Journal of Applied Crystallography , author =. 1992 , pages =. doi:10.1107/S0021889892004862 , number =

1992 doi
[162]

Zeitschrift für Kristallographie - Crystalline Materials , author =

Crystal and molecular structures of norbornene , volume =. Zeitschrift für Kristallographie - Crystalline Materials , author =. 2001 , pages =. doi:10.1524/zkri.216.1.51.18996 , abstract =

2001 doi
[163]

Powder Diffraction , author =

Monte. Powder Diffraction , author =. 2004 , pages =. doi:10.1154/1.1763152 , abstract =

2004 doi
[164]

The Computer Journal , author =

A. The Computer Journal , author =. 1965 , pages =. doi:10.1093/comjnl/7.4.308 , language =

1965 doi
[165]

Communications Materials , author =

Discovery of giant unit-cell super-structure in the infinite-layer nickelate. Communications Materials , author =. 2025 , keywords =. doi:10.1038/s43246-024-00729-4 , abstract =

2025 doi
[166]

Nature Communications , author =

Stabilization of three-dimensional charge order through interplanar orbital hybridization in. Nature Communications , author =. 2022 , keywords =. doi:10.1038/s41467-022-33607-z , abstract =

2022 doi
[167]

Nature , author =

Magnetic-field-induced charge-stripe order in the high-temperature superconductor. Nature , author =. 2011 , pages =. doi:10.1038/nature10345 , abstract =

2011 doi
[168]

X-ray diffraction observations of a charge-density-wave order in superconducting ortho-. Phys. Rev. Lett. , author =. 2013 , pages =

2013
[169]

Spatially inhomogeneous competition between superconductivity and the charge density wave in. Nat. Commun. , author =. 2020 , pages =. doi:10.1038/s41467-020-14536-1 , number =

2020 doi
[170]

Physical Review Letters , author =

Unusual electronic structure of. Physical Review Letters , author =. 1993 , pages =. doi:10.1103/PhysRevLett.70.3471 , abstract =

1993 doi
[171]

Nature Communications , author =

Magnetic field controlled charge density wave coupling in underdoped. Nature Communications , author =. 2016 , pages =

2016
[172]

Stripe order in superconducting. Phys. Rev. B , author =. 2011 , pages =. doi:10.1103/PhysRevB.83.104506 , number =

2011 doi
[173]

Nature Physics , author =

Thermodynamic phase diagram of static charge order in underdoped. Nature Physics , author =. 2013 , pages =

2013
[174]

Charge. Phys. Rev. Lett. , author =. 2021 , pages =. doi:10.1103/PhysRevLett.126.037002 , number =

2021 doi
[175]

Nernst and. Phys. Rev. Lett. , author =. 2011 , pages =

2011
[176]

Distinct charge orders in the planes and chains of ortho-. Phys. Rev. Lett. , author =. 2012 , pages =

2012
[177]

The microscopic structure of charge density waves in underdoped. Nat. Commun. , author =. 2015 , pages =. doi:10.1038/ncomms10064 , number =

2015 doi
[178]

Duffy, C. M. and Altangerel, M. and Badoux, S. and Vignolles, D. and Oustric, T. and Moir, C. M. and Feng, Keke and Frano, A. and Maple, M. B. and Taillefer, L. and Proust, C. , month = dec, year =. Charge order in the. doi:10.48550/arXiv.2512.16423 , abstract =

doi arXiv
[179]

and Noda, K

Gen, M. and Noda, K. and Shimbori, K. and Tanaka, T. and Bhoi, D. and Seki, K. and Kobayashi, H. and Gautam, K. and Akaki, M. and Ishii, Y. and Matsuda, Y. H. and Kubota, Y. and Inubushi, Y. and Yabashi, M. and Kohama, Y. and Arima, T. and Ikeda, A. , month = apr, year =. doi:...

doi
[180]

Journal of Low Temperature Physics , author =

Upper critical fields of the superconducting layered compounds. Journal of Low Temperature Physics , author =. 1984 , keywords =. doi:10.1007/BF00681811 , abstract =

1984 doi
[181]

and Gebert, T

Budden, M. and Gebert, T. and Buzzi, M. and Jotzu, G. and Wang, E. and Matsuyama, T. and Meier, G. and Laplace, Y. and Pontiroli, D. and Riccò, M. and Schlawin, F. and Jaksch, D. and Cavalleri, A. , month = may, year =. Evidence for metastable photo-induced superconductivity i...

doi
[182]

and Delacretaz, Luca and Zhu, Minhui and de la Peña Munoz, Gilberto and Sun, Stella X.-L

Mitrano, Matteo and Lee, Sangjun and Husain, Ali A. and Delacretaz, Luca and Zhu, Minhui and de la Peña Munoz, Gilberto and Sun, Stella X.-L. and Joe, Young Il and Reid, Alexander H. and Wandel, Scott F. and Coslovich, Giacomo and Schlotter, William and van Driel, Tim and Schn...

doi
[183]

Magnetoresistance of

Ando, Yoichi and Segawa, Kouji , month = apr, year =. Magnetoresistance of. Physical Review Letters , publisher =. doi:10.1103/PhysRevLett.88.167005 , abstract =

doi
[184]

Physical Review B , author =

Rotational tuning of. Physical Review B , author =. 2000 , pages =. doi:10.1103/PhysRevB.61.R14932 , language =

2000 doi
[185]

Science , author =

Crystal symmetry determination in electron diffraction using machine learning , volume =. Science , author =. 2020 , pages =. doi:10.1126/science.aay3062 , abstract =

2020 doi
[186]

Science , author =

Deeper detection limits in astronomical imaging using self-supervised spatiotemporal denoising , issn =. Science , author =. 2026 , pages =. doi:10.1126/science.ady9404 , abstract =

2026 doi
[187]

Science , author =

Mechanism for feature learning in neural networks and backpropagation-free machine learning models , volume =. Science , author =. 2024 , pages =. doi:10.1126/science.adi5639 , abstract =

2024 doi
[188]

Science , author =

Machine. Science , author =. 2001 , pages =. doi:10.1126/science.293.5537.2051 , abstract =

2001 doi
[189]

Science , author =

Machine learning:. Science , author =. 2015 , pages =. doi:10.1126/science.aaa8415 , abstract =

2015 doi
[190]

Science Advances , author =

Inverse design of soft materials via a deep learning–based evolutionary strategy , volume =. Science Advances , author =. 2022 , pages =. doi:10.1126/sciadv.abj6731 , abstract =

2022 doi
[191]

Physical Review B , author =

Magnetism and superconductivity in single-crystal. Physical Review B , author =. 1995 , pages =. doi:10.1103/PhysRevB.52.3684 , language =

1995 doi
[192]

Nernst effect in metals and superconductors: a review of concepts and experiments , volume =

Behnia, Kamran and Aubin, Hervé , month = mar, year =. Nernst effect in metals and superconductors: a review of concepts and experiments , volume =. Reports on Progress in Physics , publisher =. doi:10.1088/0034-4885/79/4/046502 , abstract =

doi
[193]

and Benhabib, S

Frachet, M. and Benhabib, S. and Vinograd, I. and Wu, S.-F. and Vignolle, B. and Mayaffre, H. and Krämer, S. and Kurosawa, T. and Momono, N. and Oda, M. and Chang, J. and Proust, C. and Julien, M.-H. and LeBoeuf, D. , month = mar, year =. High magnetic field ultrasound study o...

doi
[194]

and Shen, L

Seo, C. and Shen, L. and Petsch, A. N. and Wandel, S. and Esposito, V. and Koralek, J. D. and Dakovski, G. L. and Lin, M.-F. and Moeller, S. P. and Schlotter, W. F. and Reid, A. H. and Minitti, M. P. and Liang, R. and Bonn, D. and Hardy, W. and Damascelli, A. and Giannetti, C....

doi
[195]

Determining the electron-phonon coupling in superconducting cuprates by resonant inelastic x-ray scattering:. Phys. Rev. Research , author =. 2020 , pages =. doi:10.1103/PhysRevResearch.2.023231 , number =

2020 doi
[196]

Peng, Y. Y. and Huang, E. W. and Fumagalli, R. and Minola, M. and Wang, Y. and Sun, X. and Ding, Y. and Kummer, K. and Zhou, X. J. and Brookes, N. B. and Moritz, B. and Braicovich, L. and Devereaux, T. P. and Ghiringhelli, G. , month = oct, year =. Dispersion,. Physical Review...

doi
[197]

Machine Learning , author =

Support-vector networks , volume =. Machine Learning , author =. 1995 , keywords =. doi:10.1007/BF00994018 , abstract =

1995 doi
[198]

Proceedings of the IEEE , author =

Gradient-based learning applied to document recognition , volume =. Proceedings of the IEEE , author =. 1998 , keywords =. doi:10.1109/5.726791 , abstract =

1998 doi
[199]

and Hinton, Geoffrey E

Rumelhart, David E. and Hinton, Geoffrey E. and Williams, Ronald J. , month = oct, year =. Learning representations by back-propagating errors , volume =. Nature , publisher =. doi:10.1038/323533a0 , abstract =

doi
[200]

Psychological Review , author =

The perceptron:. Psychological Review , author =. 1958 , pages =. doi:10.1037/h0042519 , abstract =

1958 doi
[201]

Ha, David and Schmidhuber, Jürgen , month = mar, year =. World. doi:10.5281/zenodo.1207631 , abstract =

doi
[202]

Mastering diverse control tasks through world models , volume =

Hafner, Danijar and Pasukonis, Jurgis and Ba, Jimmy and Lillicrap, Timothy , month = apr, year =. Mastering diverse control tasks through world models , volume =. Nature , publisher =. doi:10.1038/s41586-025-08744-2 , abstract =

doi
[203]

Dream to

Hafner, Danijar and Lillicrap, Timothy and Ba, Jimmy and Norouzi, Mohammad , month = sep, year =. Dream to
[204]

Learning

Hafner, Danijar and Lillicrap, Timothy and Fischer, Ian and Villegas, Ruben and Ha, David and Lee, Honglak and Davidson, James , month = may, year =. Learning. Proceedings of the 36th
[205]

Castro Neto, A. H. and Guinea, F. and Peres, N. M. R. and Novoselov, K. S. and Geim, A. K. , month = jan, year =. The electronic properties of graphene , volume =. Reviews of Modern Physics , publisher =. doi:10.1103/RevModPhys.81.109 , abstract =

doi
[206]

Future of condensed matter physics for the next 10 years* , volume =

Bird, Jonathan and Cheng, Jinguang and Duan, Chun-Gang and Frederiksen, Thomas and Kahl, Gerhard and Pacchioni, Gianfranco and Park, Je-Geun and Rahman, Talat S and Schofield, Steven R and Sengupta, Krishnendu and Xu, Xiaoshan and Zhao, Jin and Dowben, Peter A , month = oct, y...

doi
[207]

and Cyr-Choinière, O

Grissonnanche, G. and Cyr-Choinière, O. and Laliberté, F. and Cotret, S. René de and Juneau-Fecteau, A. and Dufour-Beauséjour, S. and Delage, M.-È and LeBoeuf, D. and Chang, J. and Ramshaw, B. J. and Bonn, D. A. and Hardy, W. N. and Liang, R. and Adachi, S. and Hussey, N. E. a...

doi
[208]

and Proust, C

Doiron-Leyraud, N. and Proust, C. and LeBoeuf, D. and Levallois, J. and Bonnemaison, J.-B. and Liang, R. and Bonn, D. A. and Hardy, W. N. and Taillefer, L. , year =. Quantum oscillations and the. doi:10.1038/nature05872 , journal =

doi
[209]

Physical Review B , author =

Competition between spin ordering and superconductivity near the pseudogap boundary in. Physical Review B , author =. 2022 , pages =. doi:10.1103/PhysRevB.106.054522 , number =

2022 doi
[210]

Physical Review Letters , author =

Spin-. Physical Review Letters , author =. 2001 , pages =. doi:10.1103/PhysRevLett.87.067202 , number =

2001 doi
[211]

Physical Review B , author =

Vortex lattice melting and. Physical Review B , author =. 2012 , pages =. doi:10.1103/PhysRevB.86.174501 , number =

2012 doi
[212]

and Rønnow, H

Lake, B. and Rønnow, H. M. and Christensen, N. B. and Aeppli, G. and Lefmann, K. and McMorrow, D. F. and Vorderwisch, P. and Smeibidl, P. and Mangkorntong, N. and Sasagawa, T. and Nohara, M. and Takagi, H. and Mason, T. E. , month = jan, year =. Antiferromagnetic order induced...

doi
[213]

Journal of Instrumentation , author =

Characterization of. Journal of Instrumentation , author =. 2016 , pages =. doi:10.1088/1748-0221/11/12/P12013 , abstract =

2016 doi
[214]

Xu, Guowei and Zheng, Ruijie and Liang, Yongyuan and Wang, Xiyao and Yuan, Zhecheng and Ji, Tianying and Luo, Yu and Liu, Xiaoyu and Yuan, Jiaxin and Hua, Pu and Li, Shuzhen and Ze, Yanjie and Iii, Hal Daumé and Huang, Furong and Xu, Huazhe , month = jan, year =. The
[215]

Physica B: Condensed Matter , author =

Zylon-reinforced high magnetic field coils for the. Physica B: Condensed Matter , author =. 2001 , keywords =. doi:10.1016/S0921-4526(00)00738-9 , abstract =

2001 doi
[216]

Bulletin of the American Physical Society Meeting , author =

X-ray diffraction study of charge density wave fluctuations in. Bulletin of the American Physical Society Meeting , author =. 2016 , pages =

2016
[217]

and Li, Lu and Ong, N

Checkelsky, Joseph G. and Li, Lu and Ong, N. P. , month = may, year =. Zero-. Physical Review Letters , publisher =. doi:10.1103/PhysRevLett.100.206801 , abstract =

doi
[218]

Xenon iron oxides predicted as potential

Peng, Feng and Song, Xianqi and Liu, Chang and Li, Quan and Miao, Maosheng and Chen, Changfeng and Ma, Yanming , month = oct, year =. Xenon iron oxides predicted as potential. Nature Communications , publisher =. doi:10.1038/s41467-020-19107-y , abstract =

doi
[219]

and Wakabayashi, N

Shimomura, S. and Wakabayashi, N. and Kuwahara, H. and Tokura, Y. , month = nov, year =. X-ray diffuse scattering due to polarons in a colossal magnetoresistive manganite , volume =. Phys. Rev. Lett. , publisher =. doi:10.1103/PhysRevLett.83.4389 , number =

doi
[220]

and Noce, C

Brzezicki, W. and Noce, C. and Romano, A. and Cuoco, M. , year =. Zigzag and. doi:https://doi.org/10.1103/PhysRevLett.114.247002 , journal =

doi
[221]

and Green, Evan and Mathews, Irimpan I

Wilson, Samuel A. and Green, Evan and Mathews, Irimpan I. and Benfatto, Maurizio and Hodgson, Keith O. and Hedman, Britt and Sarangi, Ritimukta , month = oct, year =. X-ray absorption spectroscopic investigation of the electronic structure differences in solution and crystalli...

doi
[222]

Wien2k: An Augmented Plane Wave + Local Orbitals Program for Calculating Crystal Properties (Vienna University of Technology, Vienna, 2001) , author =

Wien2k:. Wien2k: An Augmented Plane Wave + Local Orbitals Program for Calculating Crystal Properties (Vienna University of Technology, Vienna, 2001) , author =

2001
[223]

Shi, Jueli and Zhang, Jiaye and Yang, Lu and Qu, Mei and Qi, Dong‐Chen and Zhang, Kelvin H. L. , month = apr, year =. Wide. Advanced Materials , publisher =. doi:10.1002/adma.202006230 , number =

doi
[224]

and Denner, M

Oppliger, J. and Denner, M. M. and Küspert, J. and Frison, R. and Wang, Q. and Morawietz, A. and Ivashko, O. and Dippel, A.-C. and Zimmermann, M. v and Christensen, N. B. and Kurosawa, T. and Momono, N. and Oda, M. and Natterer, F. D. and Fischer, M. H. and Neupert, T. and Cha...

doi
[225]

X-ray diffraction denoising using deep convolutional neural networks , url =

Oppliger, Jens , month = nov, year =. X-ray diffraction denoising using deep convolutional neural networks , url =. doi:10.5281/zenodo.10245374 , abstract =

doi
[226]

Physical Review B , author =

X-ray absorption spectroscopy of detwinned \ \. Physical Review B , author =. 1997 , pages =. doi:10.1103/PhysRevB.55.9160 , abstract =

1997 doi
[227]

When low- and high-energy electronic responses meet in cuprate superconductors , volume =. Phys. Rev. B , author =. 2007 , pages =. doi:10.1103/PhysRevB.75.224508 , number =

2007 doi
[228]

Technische Universität Wien , author =
[229]

Communications of the ACM , author =

Use of the. Communications of the ACM , author =. 1972 , keywords =. doi:10.1145/361237.361242 , abstract =

1972 doi
[230]

and Dalmas de Réotier, P

Yaouanc, A. and Dalmas de Réotier, P. and van der Laan, G. and Hiess, A. and Goulon, J. and Neumann, C. and Lejay, P. and Sato, N. , month = oct, year =. Uranium 5f shell in. Physical Review B , publisher =. doi:10.1103/PhysRevB.58.8793 , abstract =

doi
[231]

and Kurnosov, Alexander V

Layek, Samar and Greenberg, Eran and Chariton, Stella and Bykov, Maxim and Bykova, Elena and Trots, Dmytro M. and Kurnosov, Alexander V. and Chuvashova, Irina and Ovsyannikov, Sergey V. and Leonov, Ivan and Rozenberg, Gregory Kh. , month = jun, year =. Verwey-. Journal of the ...

doi
[232]

and Das, D

Guguchia, Z. and Das, D. and Wang, C. N. and Adachi, T. and Kitajima, N. and Elender, M. and Brückner, F. and Ghosh, S. and Grinenko, V. and Shiroka, T. and Müller, M. and Mudry, C. and Baines, C. and Bartkowiak, M. and Koike, Y. and Amato, A. and Tranquada, J. M. and Klauss, ...

doi
[233]

Nature Communications , author =

Using strain to uncover the interplay between two- and three-dimensional charge density waves in high-temperature superconducting. Nature Communications , author =. 2024 , keywords =. doi:10.1038/s41467-024-47540-w , abstract =

2024 doi
[234]

Nature Machine Intelligence , author =

Weak signal extraction enabled by deep neural network denoising of diffraction data , volume =. Nature Machine Intelligence , author =. 2024 , keywords =. doi:10.1038/s42256-024-00790-1 , abstract =

2024 doi
[235]

, month = may, year =

Jia, Chunjing and Wohlfeld, Krzysztof and Wang, Yao and Moritz, Brian and Devereaux, Thomas P. , month = may, year =. Using. Phys. Rev. X , publisher =. doi:10.1103/physrevx.6.021020 , number =

doi
[236]

Visualization of the

Lin, Chun and Ochi, Masayuki and Noguchi, Ryo and Kuroda, Kenta and Sakoda, Masahito and Nomura, Atsushi and Tsubota, Masakatsu and Zhang, Peng and Bareille, Cedric and Kurokawa, Kifu and Arai, Yosuke and Kawaguchi, Kaishu and Tanaka, Hiroaki and Yaji, Koichiro and Harasawa, A...

doi
[237]

and Hartmann, R

Fittipaldi, R. and Hartmann, R. and Mercaldo, M. T. and Komori, S. and Bjørlig, A. and Kyung, W. and Yasui, Y. and Miyoshi, T. and Olde Olthof, L. a. B. and Palomares Garcia, C. M. and Granata, V. and Keren, I. and Higemoto, W. and Suter, A. and Prokscha, T. and Romano, A. and...

doi
[238]

and Wang, Q

Choi, J. and Wang, Q. and Jöhr, S. and Christensen, N. B. and Küspert, J. and Bucher, D. and Biscette, D. and Fischer, M. H. and Hücker, M. and Kurosawa, T. and Momono, N. and Oda, M. and Ivashko, O. and Zimmermann, M. v. and Janoschek, M. and Chang, J. , month = may, year =. ...

doi
[239]

Solid State Communications , author =

Universal relationship of the resistivity and specific heat in heavy-. Solid State Communications , author =. 1986 , pages =. doi:10.1016/0038-1098(86)90785-4 , abstract =

1986 doi
[240]

Unusual. Phys. Rev. X , author =. 2020 , keywords =. doi:10.1103/PhysRevX.10.021059 , number =

2020 doi
[241]

Universal versus. Phys. Rev. Lett. , author =. 2009 , pages =. doi:10.1103/PhysRevLett.103.037004 , number =

2009 doi
[242]

Advanced Materials , author =

Universal. Advanced Materials , author =. 2023 , keywords =. doi:10.1002/adma.202307515 , number =

2023 doi
[243]

and Sigmund, E

Seibold, G. and Sigmund, E. and Hizhnyakov, V. , month = mar, year =. Unrestricted slave-boson mean-field approximation for the two-dimensional. Phys. Rev. B , publisher =. doi:10.1103/PhysRevB.57.6937 , number =

doi
[244]

Unusual. Phys. Rev. Lett. , author =. 2018 , pages =. doi:10.1103/PhysRevLett.121.167002 , number =

2018 doi
[245]

Michael and Lei, Hechang and Louat, Alex and Watson, Matthew D

Lin, Chun and Consiglio, Armando and Forslund, Ola Kenji and Küspert, Julia and Denner, M. Michael and Lei, Hechang and Louat, Alex and Watson, Matthew D. and Kim, Timur K. and Cacho, Cephise and Carbone, Dina and Leandersson, Mats and Polley, Craig and Balasubramanian, Thiaga...

doi
[246]

Uniaxial stress control of versatile helimagnetic phases in the square-lattice itinerant magnet

Gen, Masaki and Nomoto, Takuya and Saito, Hiraku and Nakajima, Taro and Tokunaga, Yusuke and Takagi, Rina and Seki, Shinichiro and Arima, Taka-hisa , year =. Uniaxial stress control of versatile helimagnetic phases in the square-lattice itinerant magnet. doi:10.48550/ARXIV.251...

doi
[247]

Uniaxial stress effect on the electronic structure of quantum materials , volume =

Jo, Na Hyun and Gati, Elena and Pfau, Heike , month = may, year =. Uniaxial stress effect on the electronic structure of quantum materials , volume =. Frontiers in Electronic Materials , publisher =. doi:10.3389/femat.2024.1392760 , abstract =

2024 doi
[248]

Unified one-band. Phys. Rev. B , author =. 2012 , pages =. doi:10.1103/PhysRevB.85.100508 , number =

2012 doi
[249]

and Mazzone, D

Wang, Qisi and von Arx, K. and Mazzone, D. G. and Mustafi, S. and Horio, M. and Küspert, J. and Choi, J. and Bucher, D. and Wo, H. and Zhao, J. and Zhang, W. and Asmara, T. C. and Sassa, Y. and Månsson, M. and Christensen, N. B. and Janoschek, M. and Kurosawa, T. and Momono, N...

doi
[250]

Nature Physics , author =

Universal quantum oscillations in the underdoped cuprate superconductors , volume =. Nature Physics , author =. 2013 , keywords =. doi:10.1038/nphys2792 , abstract =

2013 doi
[251]

and Lu, H

Rossi, M. and Lu, H. and Lee, K. and Goodge, B. H. and Choi, J. and Osada, M. and Lee, Y. and Li, D. and Wang, B. Y. and Jost, D. and Agrestini, S. and Garcia-Fernandez, M. and Shen, Z. X. and Zhou, Ke-Jin and Been, E. and Moritz, B. and Kourkoutis, L. F. and Devereaux, T. P. ...
[252]

Universal

Lefkimmiatis, Stamatios , year =. Universal. doi:10.1109/CVPR.2018.00338 , booktitle =

2018 doi
[253]

Science , author =

Uniaxial pressure control of competing orders in a high-temperature superconductor , volume =. Science , author =. 2018 , pages =. doi:10.1126/science.aat4708 , number =

2018 doi
[254]

Nature Materials , author =

Unconventional chiral charge order in kagome superconductor. Nature Materials , author =. 2021 , pages =. doi:10.1038/s41563-021-01034-y , language =

2021 doi
[255]

Physical Review Letters , author =

Unconventional. Physical Review Letters , author =. 2021 , pages =. doi:10.1103/PhysRevLett.126.076602 , language =

2021 doi
[256]

Understanding the

Luo, Wenjie and Li, Yujia and Urtasun, Raquel and Zemel, Richard , year =. Understanding the. Advances in
[257]

Unconventional superconductivity in

Aoki, D and Brison, J-P and Flouquet, J and Ishida, K and Knebel, G and Tokunaga, Y and Yanase, Y , month = apr, year =. Unconventional superconductivity in. Journal of Physics: Condensed Matter , publisher =. doi:10.1088/1361-648X/ac5863 , abstract =

doi
[258]

and Lupien, C

Benhabib, S. and Lupien, C. and Paul, I. and Berges, L. and Dion, M. and Nardone, M. and Zitouni, A. and Mao, Z. Q. and Maeno, Y. and Georges, A. and Taillefer, L. and Proust, C. , month = feb, year =. Ultrasound evidence for a two-component superconducting order parameter in....

doi
[259]

Unconventional superconductivity in magic-angle graphene superlattices , volume =

Cao, Yuan and Fatemi, Valla and Fang, Shiang and Watanabe, Kenji and Taniguchi, Takashi and Kaxiras, Efthimios and Jarillo-Herrero, Pablo , month = apr, year =. Unconventional superconductivity in magic-angle graphene superlattices , volume =. Nature , publisher =. doi:10.1038...

doi
[260]

Moser, Ewald and Laistler, Elmar and Schmitt, Franz and Kontaxis, Georg , month = aug, year =. Ultra-. Frontiers in Physics , publisher =. doi:10.3389/fphy.2017.00033 , abstract =

2017 doi
[261]

Ament, Luuk J. P. and Forte, Filomena and van den Brink, Jeroen , month = mar, year =. Ultrashort lifetime expansion for indirect resonant inelastic x-ray scattering , volume =. Phys. Rev. B , publisher =. doi:10.1103/PhysRevB.75.115118 , number =

doi
[262]

Ronneberger, Olaf and Fischer, Philipp and Brox, Thomas , editor =. U-. Medical. 2015 , keywords =. doi:10.1007/978-3-319-24574-4_28 , abstract =

2015 doi
[263]

Two-. Phys. Rev. Lett. , author =. 2010 , pages =. doi:10.1103/PhysRevLett.105.057003 , number =

2010 doi
[264]

Science , author =

Ubiquitous interplay between charge ordering and high-temperature superconductivity in cuprates , volume =. Science , author =. 2014 , pages =

2014
[265]

Nature Physics , author =

Twofold van. Nature Physics , author =. 2022 , pages =. doi:10.1038/s41567-021-01451-5 , number =

2022 doi
[266]

and Zhou, Xianjing and Pearson, John and Fisher, Brandon and Jiang, J

Liu, Changjiang and Yan, Xi and Jin, Dafei and Ma, Yang and Hsiao, Haw-Wen and Lin, Yulin and Bretz-Sullivan, Terence M. and Zhou, Xianjing and Pearson, John and Fisher, Brandon and Jiang, J. Samuel and Han, Wei and Zuo, Jian-Min and Wen, Jianguo and Fong, Dillon D. and Sun, J...

doi
[267]

Nat Commun

Two-dimensional type-. Nat Commun. , author =. 2018 , note =. doi:10.1038/s41467-018-05715-2 , number =

2018 doi
[269]

Two-carrier

Das, Lakshmi and Xu, Yang and Shang, Tian and Steppke, Alexander and Horio, Masafumi and Choi, Jaewon and Jöhr, Simon and von Arx, Karin and Mueller, Jasmin and Biscette, Dominik and Zhang, Xiaofu and Schilling, Andreas and Granata, Veronica and Fittipaldi, Rosalba and Vecchio...

doi
[270]

and Hücker, M

Li, Q. and Hücker, M. and Gu, G. D. and Tsvelik, A. M. and Tranquada, J. M. , month = aug, year =. Two-. Phys. Rev. Lett. , publisher =. doi:10.1103/PhysRevLett.99.067001 , number =

doi
[271]

Fauqué, Benoît and LeBoeuf, David and Vignolle, Baptiste and Nardone, Marc and Proust, Cyril and Behnia, Kamran , month = jun, year =. Two. Physical Review Letters , publisher =. doi:10.1103/PhysRevLett.110.266601 , abstract =

doi
[273]

2007 , pages =

Two energy scales in the spin excitations of the high-temperature superconductor. 2007 , pages =. doi:http://dx.doi.org/10.1038/nphys546 10.1038/nphys546 , journal =

2007 doi
[274]

Nature , author =

Two-dimensional electron gas with universal subbands at the surface of. Nature , author =. 2011 , pages =. doi:10.1038/nature09720 , abstract =

2011 doi
[275]

Novoselov, K. S. and Geim, A. K. and Jiang, S. V. Morozov D. and Katsnelson, M. I. and Grigorieva, I. V. and Dubonos, S. V. and Firsov, A. A. , year =. Two-dimensional gas of massless. doi:10.1038/nature04233 , journal =

doi
[276]

and Sutarto, Ronny and Gong, Rantong and Idziak, Stefan H

Gupta, Naman K. and Sutarto, Ronny and Gong, Rantong and Idziak, Stefan H. J. and Hale, Hiruy and Kim, Young-June and Hawthorn, David G. , month = sep, year =. Tuning charge density wave order and structure via uniaxial stress in a stripe-ordered cuprate superconductor , volum...

doi
[277]

Two. Chin. Phys. Lett. , author =. 2024 , pages =. doi:10.1088/0256-307X/41/11/117404 , abstract =

2024 doi
[278]

Two. Phys. Rev. Lett. , author =. 2009 , pages =. doi:10.1103/PhysRevLett.102.166402 , number =

2009 doi
[279]

Nat Phys , author =

Two energy scales and two distinct quasiparticle dynamics in the superconducting state of underdoped cuprates , volume =. Nat Phys , author =. 2006 , pages =

2006
[281]

and Veiga, L

Pincini, D. and Veiga, L. S. I. and Dashwood, C. D. and Forte, F. and Cuoco, M. and Perry, R. S. and Bencok, P. and Boothroyd, A. T. and McMorrow, D. F. , month = feb, year =. Tuning of the. Phys. Rev. B , publisher =. doi:10.1103/PhysRevB.99.075125 , number =

doi
[282]

Nature Physics , author =

Two energy scales in the spin excitations of the high-temperature superconductor. Nature Physics , author =. 2007 , pages =

2007
[283]

Tuning of charge order by uniaxial stress in a cuprate superconductor , volume =

Thomarat, Laure and Elson, Frank and Nocerino, Elisabetta and Das, Debarchan and Ivashko, Oleh and Bartkowiak, Marek and Månsson, Martin and Sassa, Yasmine and Adachi, Tadashi and Zimmermann, Martin v and Luetkens, Hubertus and Chang, Johan and Janoschek, Marc and Guguchia, Zu...

doi
[284]

Tuning competing orders in. Phys. Rev. B , author =. 2008 , pages =. doi:10.1103/PhysRevB.78.104525 , number =

2008 doi
[285]

Quantitative Imaging in Medicine and Surgery , author =

Transformers in medical image segmentation: a narrative review , volume =. Quantitative Imaging in Medicine and Surgery , author =. 2023 , pages =. doi:10.21037/qims-23-542 , abstract =

2023 doi
[286]

2024 , keywords =

Medical Image Analysis , author =. 2024 , keywords =. doi:10.1016/j.media.2024.103280 , abstract =

2024 doi
[287]

and Harii, K

Kajiwara, Y. and Harii, K. and Takahashi, S. and Ohe, J. and Uchida, K. and Mizuguchi, M. and Umezawa, H. and Kawai, H. and Ando, K. and Takanashi, K. and Maekawa, S. and Saitoh, E. , month = mar, year =. Transmission of electrical signals by spin-wave interconversion in a mag...

doi
[288]

2016 , keywords =

Computer Physics Communications , author =. 2016 , keywords =

2016
[289]

and Bhattacharya, Anand , month = feb, year =

Liu, Changjiang and Zhou, Xianjing and Hong, Deshun and Fisher, Brandon and Zheng, Hong and Pearson, John and Jiang, Jidong Samuel and Jin, Dafei and Norman, Michael R. and Bhattacharya, Anand , month = feb, year =. Tunable superconductivity and its origin at. Nat. Commun. , p...

doi
[290]

and Moreschini, L

Moser, S. and Moreschini, L. and Jaıfmmode. Tunable. Phys. Rev. Lett. , publisher =. 2013 , pages =. doi:10.1103/PhysRevLett.110.196403 , number =

2013 doi
[291]

Comput. Phys. Commun. , author =. 2016 , keywords =

2016
[292]

Comput. Phys. Commun. , author =. 2015 , pages =

2015
[293]

Nature Communications , author =

Transport phase diagram and anomalous metallicity in superconducting infinite-layer nickelates , volume =. Nature Communications , author =. 2024 , keywords =. doi:10.1038/s41467-024-54135-y , abstract =

2024 doi
[294]

Towards vision-based deep reinforcement learning for robotic motion control , url =

Zhang, Fangyi and Leitner, Jürgen and Milford, Michael and Upcroft, Ben and Corke, Peter , year =. Towards vision-based deep reinforcement learning for robotic motion control , url =. Australasian
[295]

Ravelli, R. B. G. and Hezemans, A. M. F. and Krabbendam, H. and Kroon, J. , month = jun, year =. Towards. Journal of Applied Crystallography , publisher =. doi:10.1107/S0021889895015676 , abstract =

doi
[296]

Training

Tremblay, Jonathan and Prakash, Aayush and Acuna, David and Brophy, Mark and Jampani, Varun and Anil, Cem and To, Thang and Cameracci, Eric and Boochoon, Shaad and Birchfield, Stan , month = jun, year =. Training. 2018. doi:10.1109/CVPRW.2018.00143 , abstract =

2018 doi
[297]

Ultramicroscopy , author =

Towards automatic alignment of a crystalline sample in an electron microscope along a zone axis , volume =. Ultramicroscopy , author =. 2013 , keywords =. doi:10.1016/j.ultramic.2012.09.010 , abstract =

2013 doi
[298]

Nature Materials , author =

Topological semimetals , volume =. Nature Materials , author =. 2016 , pages =. doi:10.1038/nmat4788 , language =

2016 doi
[299]

and Lazarov, Marina and Weyer, Stefan and Di Rocco, Tommaso and Folco, Luigi and Pack, Andreas , month = jul, year =

Zahnow, Fabian and Suttle, Martin D. and Lazarov, Marina and Weyer, Stefan and Di Rocco, Tommaso and Folco, Luigi and Pack, Andreas , month = jul, year =. Traces of the oxygen isotope composition of ancient air in fossilized cosmic dust , volume =. Communications Earth & Envir...

doi
[300]

Luke, G. M. and Fudamoto, Y. and Kojima, K. M. and Larkin, M. I. and Merrin, J. and Nachumi, B. and Uemura, Y. J. and Maeno, Y. and Mao, Z. Q. and Mori, Y. and Nakamura, H. and Sigrist, M. , month = aug, year =. Time-reversal symmetry-breaking superconductivity in. Nature , pu...

doi

Pith tools

Reviewed June 27, 2026 · model on record in the stance chip above.

[1] [1]

Physical Review B , author =

O 17. Physical Review B , author =. 2005 , pages =. doi:10.1103/PhysRevB.72.014537 , language =

work page doi:10.1103/physrevb.72.014537 2005

[2] [2]

Wu , author H

Emergence of charge order from the vortex state of a high-temperature superconductor , volume =. Nature Communications , author =. 2013 , keywords =. doi:10.1038/ncomms3113 , abstract =

work page doi:10.1038/ncomms3113 2013

[3] [3]

Girod, D

Normal state specific heat in the cuprate superconductors. Physical Review B , author =. 2021 , pages =. doi:10.1103/PhysRevB.103.214506 , language =

work page doi:10.1103/physrevb.103.214506 2021

[4] [4]

Image quality assessment: From error visibility to structural similarity.Image Processing, IEEE Transactions on, 13:600 – 612, 05 2004

Image quality assessment: from error visibility to structural similarity , volume =. IEEE Transactions on Image Processing , author =. 2004 , pages =. doi:10.1109/TIP.2003.819861 , number =

work page doi:10.1109/tip.2003.819861 2004

[5] [5]

Proceedings of the 33rd

Paszke, Adam and Gross, Sam and Massa, Francisco and Lerer, Adam and Bradbury, James and Chanan, Gregory and Killeen, Trevor and Lin, Zeming and Gimelshein, Natalia and Antiga, Luca and Desmaison, Alban and Köpf, Andreas and Yang, Edward and DeVito, Zach and Raison, Martin and Tejani, Alykhan and Chilamkurthy, Sasank and Steiner, Benoit and Fang, Lu and B...

[6] [6]

MarketsandMarkets , note =

Cryo-electron. MarketsandMarkets , note =

[7] [7]

Physical Review B , author =

Existence of electron and hole pockets and partial gap opening in the correlated semimetal. Physical Review B , author =. 2018 , pages =. doi:10.1103/PhysRevB.97.041113 , language =

work page doi:10.1103/physrevb.97.041113 2018

[8] [8]

Radiation Measurements , author =

An introduction to the. Radiation Measurements , author =. 2020 , keywords =. doi:10.1016/j.radmeas.2020.106271 , abstract =

work page doi:10.1016/j.radmeas.2020.106271 2020