Pith. sign in

REVIEW 2 major objections 5 minor 79 references

Defect Physics of Pseudo-cubic Mixed Halide Lead Perovskites from First Principles

T0 review · 2 major / 5 minor · reviewed 2026-08-14 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read Chlorine-containing lead halide perovskites host low-energy halogen vacancies whose donor levels sit deep in the band gap, and the levels sink further as the chlorine fraction rises.

desk verdict A competent and useful compositional sweep of defect physics in mixed halide perovskites, with a central Cl-induced deep-level trend that is plausible but rests on an untested PBE error-cancellation assumption. read the letter →

arxiv 1908.05585 v1 pith:2B2IPRU3 submitted 2019-08-15 physics.app-ph cond-mat.mtrl-sci

Arun Mannodi-Kanakkithodi , Ji-Sang Park , Alex B.F. Martinson , Maria K.Y. Chan This is my paper · ORCID
classification physics.app-phcond-mat.mtrl-sci
keywords hybridperovskitesdefectphysicschargetransitionlevelshalogenvacanciesmixedhalidedensityfunctionaltheorymetalsubstitutionphotovoltaics
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

Using density functional theory on pseudo-cubic crystal models, this paper tracks the native point defects of methylammonium lead halide perovskites as the halide mix shifts from iodine to bromine to chlorine. It finds that the lowest-energy intrinsic defects—halogen vacancies and the lead-on-MA anti-site defect—produce only shallow levels in all iodide-bromide compositions, but in chlorine-containing perovskites the bromine or chlorine vacancy creates a deep donor level that moves further from the conduction-band edge as chlorine content rises. If correct, the defect tolerance that makes iodide and bromide perovskites good photovoltaic absorbers does not carry over to bromide-chloride and pure-chloride compositions, which would help explain their poorer solar-cell performance. The same calculations identify a handful of transition metals (scandium, zirconium, hafnium, molybdenum, yttrium) that form low-energy donor defects at the lead site and can shift the equilibrium conductivity.

What carries the argument

The load-bearing object is the charge transition level, the Fermi energy at which a defect's stable charge state changes, computed from formation energies of the same defect in different charge states through $E^f(D^q,E_F) = E(D^q)-8E(\mathrm{MAPbX_3})-\mu_D+qE_F+E_{\mathrm{corr}}$, with chemical potentials set by each perovskite's stability range and $E_{\mathrm{corr}}$ from the standard charged-defect finite-size correction. The paper defines a level as deep when it lies more than 0.2 eV from either band edge, and aligns all levels across compositions to the nitrogen 1s core state. Mixed-halide compositions are represented by special quasi-random structures in 96-atom supercells, and the comparison of transition levels across nine compositions is what carries the conclusion that the same vacancy defect turns from shallow to deep as chlorine content increases.

What would settle it

Calculate the $+1/0$ halogen-vacancy transition levels in $\mathrm{MAPbBr_{2.25}Cl_{0.75}}$ and $\mathrm{MAPbCl_3}$ using a hybrid functional with spin-orbit coupling: if the levels fall within 0.2 eV of the conduction-band edge rather than 0.59–1 eV below it, the reported deepening is a computational artifact. A complementary experiment is deep-level transient spectroscopy on $\mathrm{MAPbCl_3}$ single crystals, which should show a donor trap near 1 eV below the conduction band if the paper's prediction is correct.

Watch

Extended reading notes

Core claim

The paper's central discovery is a composition-driven change in defect character across the series $\mathrm{MAPbI_3}$, $\mathrm{MAPbI_{3-y}Br_y}$, $\mathrm{MAPbBr_3}$, $\mathrm{MAPbBr_{3-y}Cl_y}$, and $\mathrm{MAPbCl_3}$. In the nine pseudo-cubic compounds studied, the lowest-energy intrinsic defects are the cation vacancies $V_{\mathrm{Pb}}$ and $V_{\mathrm{MA}}$, the halogen vacancy $V_X$ ($X=\mathrm{I},\mathrm{Br},\mathrm{Cl}$), and the lead-on-MA anti-site $\mathrm{Pb_{MA}}$; all form in their expected charge states. For every iodide-bromide composition, the donor $+1/0$ transition levels of $V_{\mathrm{I}}$ and $V_{\mathrm{Br}}$ lie within the paper's shallow definition, within 0.2 eV of a band edge. In the chlorine-bearing perovskites, by contrast, the $+1/0$ levels of $V_{\mathrm{Br}}$ and $V_{\mathrm{Cl}}$ sit 0.35 eV below the conduction-band minimum in $\mathrm{MAPbBr_{2.25}Cl_{0.75}}$ and deepen to 0.59, 0.76, and nearly 1 eV in $\mathrm{MAPbCl_3}$. The paper concludes that chlorine-containing lead halide perovskites host low-energy intrinsic donor traps, and that this loss of defect tolerance likely contributes to their limited photovoltaic performance.

Load-bearing premise

The entire deep-versus-shallow comparison rests on the assumption that two errors in the density-functional calculation—missing spin-orbit coupling and underestimation of the band gap—cancel each other out in chlorine-rich perovskites just as they did in the bromide perovskite studied earlier.

Editorial extensions

If this is right

  • If the deep $V_{\mathrm{Br}}$ and $V_{\mathrm{Cl}}$ donor levels are present in real crystals, chloride and bromide-chloride perovskites should exhibit faster nonradiative recombination and shorter carrier lifetimes than iodide-rich perovskites under comparable conditions.
  • Composition engineering of the halide site is not defect-neutral: moving toward chlorine trades band-gap tunability for intrinsic deep traps, so wide-gap members of the family are better suited to tandem or intermediate-band configurations than to single-junction solar cells.
  • A handful of transition metals (Sc, Zr, Hf, Mo, Y) form lead-site donor defects with lower formation energy than the dominant intrinsic donors, so intentional substitution can compensate those intrinsic defects and push the equilibrium Fermi level toward n-type.
  • Extrinsic transition-metal levels that fall mid-gap could in principle support two-step sub-gap photon absorption, making such impurities useful for intermediate-band photovoltaics rather than only harmful recombination centers.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Beyond the paper, the assumption that the chosen density-functional errors and spin-orbit effects cancel in chlorine-rich crystals is the main thing to test; a hybrid-functional calculation with spin-orbit coupling on $\mathrm{MAPbCl_3}$ would confirm or refute the deepening trend.
  • The same halogen-vacancy chemistry may extend to other chloride perovskites, such as $\mathrm{CsPbCl_3}$, where chlorine vacancies could also be deep donors; this is an inference, not a result of the paper.
  • The predicted deep donor level near 1 eV below the conduction band in $\mathrm{MAPbCl_3}$ is directly measurable by deep-level transient spectroscopy on chloride single crystals, providing a clean experimental test.
  • The composition trend implies that defect-tolerant versus trap-limited behavior could be engineered by dilute Br/Cl ratios near the crossover, a lever the paper does not explicitly explore.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

2 major / 5 minor

Summary. The paper presents a first-principles DFT study of point defects in nine pseudo-cubic methylammonium lead halide perovskites spanning MAPbI3 to MAPbCl3. Using 96-atom supercells with special quasirandom structures for mixed halides, the authors compute formation energies and charge transition levels for native vacancies, interstitials, and antisites, as well as for 15 extrinsic Pb-site substituents in three compositions. They report that halogen vacancies and Pb_MA are the lowest-energy native defects; in iodide-bromide systems these defects produce only shallow transition levels, but in bromide-chloride systems the VBr/VCl +1/0 level deepens monotonically with Cl content, from 0.35 eV below the CBM in MAPbBr2.25Cl0.75 to nearly 1 eV in MAPbCl3. The paper also identifies Sc, Zr, Hf, Mo, and Y as low-energy donor impurities that can dominate over intrinsic defects and create mid-gap levels.

Significance. The reported composition-dependent deep-to-shallow crossover in halogen-vacancy levels is a potentially important result for perovskite optoelectronics, as it suggests that Cl-rich compositions are intrinsically less defect-tolerant than their I/Br counterparts. If the trend withstands higher-level validation, it provides a rationale for the poorer photovoltaic performance of Cl-containing wide-bandgap perovskites and could guide tandem or intermediate-band device designs. The study is systematic, uses standard defect-formation-energy methodology with Freysoldt finite-size corrections and explicit chemical-potential conditions, and makes no fitted parameters for the target defect energetics; the 15-element extrinsic screening adds practical value.

major comments (2)
  1. [Methods (DFT approximations)] The central claim that VBr and VCl +1/0 levels deepen with Cl content is computed at PBE without spin-orbit coupling, and the authors rely on a single sentence asserting that SOC and HSE06 corrections 'cancel each other out' based on ref. 16. This cancellation is not demonstrated for Cl-rich compositions, where the VBM is increasingly Cl-3p-derived and the PBE band gap rises to about 2.55 eV; the CBM remains Pb-6p. Because the deep-level trend in Fig. 3 is the headline result, the authors need to provide either HSE06+SOC test calculations for MAPbCl3 and at least one mixed Br-Cl composition, or a quantitative breakdown from ref. 16 showing the halogen-dependent composition of the cancellation. Without this, the reported deepening could be an artifact of the functional rather than a physical trend.
  2. [Fig. 2 and discussion] The statement that halogen vacancies are 'low energy' defects with deep levels is presented mainly for Pb-rich conditions (Fig. 2). However, the text later generalizes this to all Cl-containing perovskites. Since V_X formation energies increase under halogen-rich conditions, the authors should quantify the chemical-potential range over which the deep V_X levels are among the lowest-energy donors, or explicitly show that the same transition-level positions appear in the moderate and halogen-rich figures (Fig. SI4–SI12). This is necessary to support the conclusion that Cl-rich perovskites 'have low energy and form deep levels' as a general property.
minor comments (5)
  1. [Abstract] The word 'pervoskites' in the abstract should be corrected to 'perovskites'.
  2. [Definition of deep/shallow levels] The classification of a transition level as 'deep' at a distance greater than 0.2 eV from the band edge is arbitrary; a brief justification or a reference for this threshold would help readers interpret the central claim.
  3. [Fig. 3 caption] The nitrogen 1s core-level alignment used in Fig. 3 is mentioned but not described; a short explanation of how the core-level referencing was performed (for example, average electrostatic potential alignment) would improve reproducibility.
  4. [Table I] The tolerance and octahedral factors are listed for bromide and chloride lattices but not for the mixed MAPbBr1.5Cl1.5 compound; please specify the structural parameters used for the mixed case.
  5. [References] There are several OCR-type errors in the reference list (for example, ref. 17 contains garbled characters); these should be corrected in the final version.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: the defect transition levels are direct DFT outputs, and the one self-citation is methodological validation, not an input-defining the result.

full rationale

The paper's central claim—that Br or Cl vacancy +1/0 transition levels deepen with Cl content—is obtained from explicit DFT total-energy calculations via Eq. (1) for defect formation energies and the crossing of charge-state formation-energy lines. No parameter is fitted to the reported transition levels, and the deep-level values in Fig. 3 are not used as inputs to any model. The chemical potentials enter formation energies but cancel in the transition-level differences, so the central trend is independent of chemical-potential choices. The only self-citation is ref. 16, used to justify the PBE-without-SOC approximation by stating that SOC and HSE06 corrections cancel; this is a methodological validation rather than a step that defines the defect physics, and the prior work compared its results to measured quantities. A concern that the cancellation may not transfer to Cl-rich compositions is a correctness or risk issue, not circularity, because the calculation is still self-contained and the result would stand or fall on the accuracy of the approximation rather than on the input containing the output. No equation or definition reduces the claimed prediction to its own inputs, so no circular step is present.

Assumptions & free parameters 1 free parameters · 5 assumptions · 0 invented entities

The paper introduces no new particles, forces, or conserved quantities. Its central claims rest on standard DFT methodology plus several modeling shortcuts: PBE without SOC, pseudo-cubic structures, single SQS configurations, and hand-selected chemical-potential conditions. The only hand-chosen numerical parameter affecting presentation is the 0.2 eV threshold for calling a level deep.

free parameters (1)
  • deep-level classification threshold = 0.2 eV from VBM or CBM
    Hand-chosen cutoff used to classify transition levels as deep or shallow. The relative deepening trend of VBr and VCl levels is robust to small changes in this threshold, but the absolute label given to a specific composition depends on it.
assumptions (5)
  • domain assumption PBE-level DFT without spin-orbit coupling provides reliable qualitative defect formation energies and transition levels for these perovskites.
    The authors state that SOC and HSE06 corrections cancel based on prior work, but they do not test this for the Cl-rich compositions where the central deep-level claim is made.
  • domain assumption Pseudo-cubic crystal structures adequately represent the physics of all nine compositions, including MAPbI3, which is tetragonal under ambient conditions.
    Used for ease of comparison and simulation; the paper acknowledges the real phase for MAPbI3 differs, and possible effects on defect energetics are not quantified.
  • domain assumption A single special quasi-random structure per mixed-halide composition represents the random alloy adequately.
    No configurational averaging is performed, so local halogen ordering effects on defect levels are not captured.
  • domain assumption Freysoldt finite-size corrections fully account for image-charge interactions in charged-defect supercell calculations.
    Standard practice in charged-defect DFT, but the residual error for the 96-atom supercell is not estimated here.
  • domain assumption Chemical potentials are bounded by competing phase formation energies selected from the calculated stability ranges.
    The formation-energy scale of every defect depends on these chemical-potential choices; the paper uses Pb-rich, halogen-rich, and moderate conditions.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Defect Physics of Pseudo-cubic Mixed Halide Lead Perovskites from First Principles." pith.science (2026). https://pith.science/paper/2B2IPRU3

@misc{pith2026190805585,
  author       = {Pith},
  title        = {Pith review of: Defect Physics of Pseudo-cubic Mixed Halide Lead Perovskites from First Principles},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/2B2IPRU3}},
  note         = {Machine review of arXiv:1908.05585}
}
read the original abstract

Owing to the increasing popularity of lead-based hybrid perovskites for photovoltaic (PV) applications, it is crucial to understand their defect physics and its influence on their optoelectronic properties. In this work, we simulate various point defects in pseudo-cubic structures of mixed iodide-bromide and bromide-chloride methylammonium lead perovskites with the general formula MAPbI_{3-y}Br_{y} or MAPbBr_{3-y}Cl_{y} (where y is between 0 and 3), and use first principles based density functional theory computations to study their relative formation energies and charge transition levels. We identify vacancy defects and Pb on MA anti-site defect as the lowest energy native defects in each perovskite. We observe that while the low energy defects in all MAPbI_{3-y}Br_{y} systems only create shallow transition levels, the Br or Cl vacancy defects in the Cl-containing pervoskites have low energy and form deep levels which become deeper for higher Cl content. Further, we study extrinsic substitution by different elements at the Pb site in MAPbBr_{3}, MAPbCl_{3} and the 50-50 mixed halide perovskite, MAPbBr_{1.5}Cl_{1.5}, and identify some transition metals that create lower energy defects than the dominant intrinsic defects and also create mid-gap charge transition levels.

Figures

Figures reproduced from arXiv: 1908.05585 by the authors.

Figure 1
Figure 1. FIG. 1: (a) DFT computed lattice constant and band gap variation for different perovskite compositions from MAPbI [PITH_FULL_IMAGE:figures/full_fig_p002_1.png] view at source ↗
Figure 2
Figure 2. It is seen that although the acceptor type defects V [PITH_FULL_IMAGE:figures/full_fig_p003_2.png] view at source ↗
Figure 2
Figure 2. FIG. 2: Calculated formation energies of intrinsic point defects under Pb-rich chemical potential conditions in (a) MAPbI [PITH_FULL_IMAGE:figures/full_fig_p004_2.png] view at source ↗
Figures from the paper (3 more)
Figure 3
Figure 3. Figure 3: FIG. 3: Relevant charge transition levels of dominant intrinsic defects in the 9 perovskites. MAPbI [PITH_FULL_IMAGE:figures/full_fig_p005_3.png]
Figure 4
Figure 4. Figure 4: FIG. 4: Computed formation energies of extrinsic substitutional defects in (a) MAPbBr [PITH_FULL_IMAGE:figures/full_fig_p007_4.png]
Figure 5
Figure 5. Figure 5: FIG. 5: Computed charge transition levels of extrinsic [PITH_FULL_IMAGE:figures/full_fig_p008_5.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

79 extracted references · 53 canonical work pages

  1. [1]

    merlin.mbs aapmrev4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked

    FUNCTION id.bst "merlin.mbs aapmrev4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked" ENTRY address archive archivePrefix author bookaddress booktitle chapter collaboration doi edition editor eid eprint howpublished institution isbn issn journal key language month note number organization pages primaryClass publisher school SLACcitation series title translat...

    2010

  2. [2]

    merlin.mbs aipauth4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked

    FUNCTION id.bst "merlin.mbs aipauth4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked" ENTRY address archive archivePrefix author bookaddress booktitle chapter collaboration doi edition editor eid eprint howpublished institution isbn issn journal key language month note number organization pages primaryClass publisher school SLACcitation series title translat...

    2010

  3. [3]

    merlin.mbs aipnum4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked

    FUNCTION id.bst "merlin.mbs aipnum4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked" ENTRY address archive archivePrefix author bookaddress booktitle chapter collaboration doi edition editor eid eprint howpublished institution isbn issn journal key language month note number organization pages primaryClass publisher school SLACcitation series title translati...

    2010

  4. [4]

    author author H. J. \ Queisser \ and\ author E. E. \ Haller ,\ title title Defects in semiconductors: Some fatal, some vital , \ 10.1126/science.281.5379.945 journal journal Science \ volume 281 ,\ pages 945--950 ( year 1998 ) ,\ http://arxiv.org/abs/http://science.sciencemag.org/content/281/5379/945.full.pdf http://science.sciencemag.org/content/281/5379...

    doi:10.1126/science.281.5379.945 1998

  5. [5]

    author author P. A. \ Schultz ,\ title title Theory of defect levels and the ``band gap problem'' in silicon , \ 10.1103/PhysRevLett.96.246401 journal journal Phys. Rev. Lett. \ volume 96 ,\ pages 246401 ( year 2006 ) NoStop

    work page doi:10.1103/physrevlett.96.246401 2006

  6. [6]

    Krasikov \ and\ author I

    author author D. Krasikov \ and\ author I. Sankin ,\ title title Defect interactions and the role of complexes in the cdte solar cell absorber , \ 10.1039/C6TA09155E journal journal J. Mater. Chem. A \ volume 5 ,\ pages 3503--3513 ( year 2017 ) NoStop

    work page doi:10.1039/c6ta09155e

  7. [7]

    Kim , author J.-S

    author author S. Kim , author J.-S. \ Park , \ and\ author A. Walsh ,\ title title Identification of killer defects in kesterite thin-film solar cells , \ 10.1021/acsenergylett.7b01313 journal journal ACS Energy Letters \ volume 3 ,\ pages 496--500 ( year 2018 ) ,\ http://arxiv.org/abs/https://doi.org/10.1021/acsenergylett.7b01313 https://doi.org/10.1021/...

    work page doi:10.1021/acsenergylett.7b01313

  8. [8]

    \ Yin , author T

    author author W.-J. \ Yin , author T. Shi , \ and\ author Y. Yan ,\ title title Unusual defect physics in ch3nh3pbi3 perovskite solar cell absorber , \ 10.1063/1.4864778 journal journal Applied Physics Letters \ volume 104 ,\ pages 063903 ( year 2014 ) ,\ http://arxiv.org/abs/https://doi.org/10.1063/1.4864778 https://doi.org/10.1063/1.4864778 NoStop

    work page doi:10.1063/1.4864778

Show all 79 references
  1. [9]

    Shi , author W.-J

    author author T. Shi , author W.-J. \ Yin , author F. Hong , author K. Zhu , \ and\ author Y. Yan ,\ title title Unipolar self-doping behavior in perovskite ch3nh3pbbr3 , \ 10.1063/1.4914544 journal journal Applied Physics Letters \ volume 106 ,\ pages 103902 ( year 2015 ) ,\ ...

    doi

  2. [10]

    author author J. S. \ Park , author S. Kim , author Z. Xie , \ and\ author A. Walsh ,\ title title Point defect engineering in thin-film solar cells , \ 10.1038/s41578-018-0026-7 journal journal Nature Reviews Materials \ volume 2058-8437 ( year 2018 ),\ 10.1038/s41578-018-002...

    doi

  3. [11]

    Meggiolaro \ and\ author F

    author author D. Meggiolaro \ and\ author F. De Angelis ,\ title title First-principles modeling of defects in lead halide perovskites: Best practices and open issues , \ 10.1021/acsenergylett.8b01212 journal journal ACS Energy Letters \ volume 3 ,\ pages 2206--2222 ( year 201...

    doi

  4. [12]

    Luque \ and\ author A

    author author A. Luque \ and\ author A. Mart\' ,\ title title Increasing the efficiency of ideal solar cells by photon induced transitions at intermediate levels , \ 10.1103/PhysRevLett.78.5014 journal journal Phys. Rev. Lett. \ volume 78 ,\ pages 5014--5017 ( year 1997 ) NoStop

    doi

  5. [13]

    Luque , author A

    author author A. Luque , author A. Marti , \ and\ author C. Stanley ,\ title title Understanding intermediate-band solar cells , \ 10.1038/nphoton.2012.1 journal journal Nature Photonics \ volume 6 ,\ pages 146--152 ( year 2012 ) NoStop

    2012 doi

  6. [14]

    Mart\' , author E

    author author A. Mart\' , author E. Antol\' n , author C. R. \ Stanley , author C. D. \ Farmer , author N. L\'opez , author P. D\' az , author E. C\'anovas , author P. G. \ Linares , \ and\ author A. Luque ,\ title title Production of photocurrent due to intermediate-to-conduc...

    doi

  7. [15]

    author author S. Sonoda ,\ title title Partially filled intermediate band of cr-doped gan films , \ 10.1063/1.4717716 journal journal Applied Physics Letters \ volume 100 ,\ pages 202101 ( year 2012 ) ,\ http://arxiv.org/abs/https://doi.org/10.1063/1.4717716 https://doi.org/10...

    2012 doi

  8. [16]

    Wahn\'on \ and\ author C

    author author P. Wahn\'on \ and\ author C. Tablero ,\ title title Ab initio electronic structure calculations for metallic intermediate band formation in photovoltaic materials , \ 10.1103/PhysRevB.65.165115 journal journal Phys. Rev. B \ volume 65 ,\ pages 165115 ( year 2002 ) NoStop

    doi

  9. [17]

    Okada , author N

    author author Y. Okada , author N. J. \ Ekins-Daukes , author T. Kita , author R. Tamaki , author M. Yoshida , author A. Pusch , author O. Hess , author C. C. \ Phillips , author D. J. \ Farrell , author K. Yoshida , author N. Ahsan , author Y. Shoji , author T. Sogabe , \ and...

    doi

  10. [18]

    author author M. D. \ Sampson , author J. S. \ Park , author R. D. \ Schaller , author M. K. Y. \ Chan , \ and\ author A. B. F. \ Martinson ,\ title title Transition metal-substituted lead halide perovskite absorbers , \ 10.1039/C6TA09745F journal journal J. Mater. Chem. A \ v...

    doi

  11. [19]

    Mannodi-Kanakkithodi , author J.-S

    author author A. Mannodi-Kanakkithodi , author J.-S. \ Park , author N. Jeon , author D. H. \ Cao , author D. J. \ Gosztola , author A. B. F. \ Martinson , \ and\ author M. K. Y. \ Chan ,\ title title Comprehensive computational study of partial lead substitution in methylammo...

    doi

  12. [20]

    author author D. H. \ Cao , author P. Guo , author A. Mannodi-Kanakkithodi , author G. P. \ Wiederrecht , author D. J. \ Gosztola , author N. Jeon , author R. D. \ Schaller , author M. K. Y. \ Chan , \ and\ author A. B. F. \ Martinson ,\ title title Charge transfer dynamics of...

    doi

  13. [21]

    Heo , author G

    author author S. Heo , author G. Seo , author Y. Lee , author D. Lee , author M. Seol , author J. Lee , author J.-B. \ Park , author K. Kim , author D.-J. \ Yun , author Y. S. \ Kim , author J. K. \ Shin , author T. K. \ Ahn , \ and\ author M. K. \ Nazeeruddin ,\ title title D...

    doi

  14. [22]

    author author J. W. \ Rosenberg , author M. J. \ Legodi , author Y. Rakita , author D. Cahen , \ and\ author M. Diale ,\ title title Laplace current deep level transient spectroscopy measurements of defect states in methylammonium lead bromide single crystals , \ 10.1063/1.499...

    doi

  15. [23]

    Freysoldt , author J

    author author C. Freysoldt , author J. Neugebauer , \ and\ author C. G. \ Van de Walle ,\ title title Fully ab initio finite-size corrections for charged-defect supercell calculations , \ 10.1103/PhysRevLett.102.016402 journal journal Phys. Rev. Lett. \ volume 102 ,\ pages 016...

    doi

  16. [24]

    Freysoldt , author B

    author author C. Freysoldt , author B. Grabowski , author T. Hickel , author J. Neugebauer , author G. Kresse , author A. Janotti , \ and\ author C. G. \ Van de Walle ,\ title title First-principles calculations for point defects in solids , \ 10.1103/RevModPhys.86.253 journal...

    doi

  17. [25]

    Kojima , author K

    author author A. Kojima , author K. Teshima , author Y. Shirai , \ and\ author T. Miyasaka ,\ title title Organometal halide perovskites as visible-light sensitizers for photovoltaic cells , \ 10.1021/ja809598r journal journal Journal of the American Chemical Society \ volume ...

    doi

  18. [26]

    \ Im , author C.-R

    author author J.-H. \ Im , author C.-R. \ Lee , author J.-W. \ Lee , author S.-W. \ Park , \ and\ author N.-G. \ Park ,\ title title 6.5 solar cell , \ 10.1039/C1NR10867K journal journal Nanoscale \ volume 3 ,\ pages 4088--4093 ( year 2011 ) NoStop

    doi

  19. [27]

    Baikie , author Y

    author author T. Baikie , author Y. Fang , author J. M. \ Kadro , author M. Schreyer , author F. Wei , author S. G. \ Mhaisalkar , author M. Graetzel , \ and\ author T. J. \ White ,\ title title Synthesis and crystal chemistry of the hybrid perovskite (ch3nh3)pbi3 for solid-st...

    doi

  20. [28]

    Zhou , author J

    author author X. Zhou , author J. Jankowska , author H. Dong , \ and\ author O. V. \ Prezhdo ,\ title title Recent theoretical progress in the development of perovskite photovoltaic materials , \ https://doi.org/10.1016/j.jechem.2017.10.010 journal journal Journal of Energy Ch...

    doi

  21. [29]

    author author T. M. \ Brenner , author D. A. \ Egger , author L. Kronik , author G. Hodes , \ and\ author D. Cahen ,\ title title Hybrid organic—inorganic perovskites: low-cost semiconductors with intriguing charge-transport properties , \ 10.1038/natrevmats.2015.7 journal jou...

    doi

  22. [30]

    Shen , author T

    author author H. Shen , author T. Duong , author Y. Wu , author J. Peng , author D. Jacobs , author N. Wu , author K. Weber , author T. White , \ and\ author K. Catchpole ,\ title title Metal halide perovskite: a game-changer for photovoltaics and solar devices via a tandem de...

  23. [31]

    author author J. S. \ Manser , author J. A. \ Christians , \ and\ author P. V. \ Kamat ,\ title title Intriguing optoelectronic properties of metal halide perovskites , \ 10.1021/acs.chemrev.6b00136 journal journal Chemical Reviews \ volume 116 ,\ pages 12956--13008 ( year 201...

    doi

  24. [32]

    Qiu , author L

    author author L. Qiu , author L. K. \ Ono , \ and\ author Y. Qi ,\ title title Advances and challenges to the commercialization of organic–inorganic halide perovskite solar cell technology , \ https://doi.org/10.1016/j.mtener.2017.09.008 journal journal Materials Today Energy ...

    doi

  25. [33]

    \ Yin , author J.-H

    author author W.-J. \ Yin , author J.-H. \ Yang , author J. Kang , author Y. Yan , \ and\ author S.-H. \ Wei ,\ title title Halide perovskite materials for solar cells: a theoretical review , \ 10.1039/C4TA05033A journal journal J. Mater. Chem. A \ volume 3 ,\ pages 8926--8942...

    doi

  26. [34]

    Yan , author W.-J

    author author Y. Yan , author W.-J. \ Yin , author T. Shi , author W. Meng , \ and\ author C. Feng ,\ title Defect physics of ch3nh3pbx3 (x = i, br, cl) perovskites , \ in\ 10.1007/978-3-319-35114-8_4 booktitle Organic-Inorganic Halide Perovskite Photovoltaics: From Fundamenta...

    doi

  27. [35]

    author author C. A. \ López , author M. V. \ Martínez-Huerta , author M. C. \ Alvarez-Galván , author P. Kayser , author P. Gant , author A. Castellanos-Gomez , author M. T. \ Fernández-Díaz , author F. Fauth , \ and\ author J. A. \ Alonso ,\ title title Elucidating the methyl...

    doi

  28. [36]

    author author L. D. \ Whalley , author J. M. \ Frost , author Y.-K. \ Jung , \ and\ author A. Walsh ,\ title title Perspective: Theory and simulation of hybrid halide perovskites , \ 10.1063/1.4984964 journal journal The Journal of Chemical Physics \ volume 146 ,\ pages 220901...

    doi

  29. [37]

    Liu , author W

    author author C. Liu , author W. Li , author J. Fan , \ and\ author Y. Mai ,\ title title A brief review on the lead element substitution in perovskite solar cells , \ https://doi.org/10.1016/j.jechem.2017.10.028 journal journal Journal of Energy Chemistry \ ( year 2017 ),\ ht...

    2017 doi

  30. [38]

    Gong , author P

    author author J. Gong , author P. Guo , author S. E. \ Benjamin , author P. G. V. \ Patten , author R. D. \ Schaller , \ and\ author T. Xu ,\ title title Cation engineering on lead iodide perovskites for stable and high-performance photovoltaic applications , \ https://doi.org...

    doi

  31. [39]

    Yang , author X

    author author Y. Yang , author X. Zou , author Y. Pei , author X. Bai , author W. Jin , \ and\ author D. Chen ,\ title title Effect of doping of nai monovalent cation halide on the structural, morphological, optical and optoelectronic properties of mapbi3 perovskite , \ bookti...

    2017

  32. [40]

    author author I. J. \ Park , author S. Seo , author M. A. \ Park , author S. Lee , author D. H. \ Kim , author K. Zhu , author H. Shin , \ and\ author J. Y. \ Kim ,\ title title Effect of rubidium incorporation on the structural, electrical, and photovoltaic properties of meth...

    doi

  33. [41]

    Shirahata \ and\ author T

    author author Y. Shirahata \ and\ author T. Oku ,\ title title Photovoltaic properties of cu-doped ch3nh3pbi3 with perovskite structure , \ 10.1063/1.4974790 journal journal AIP Conference Proceedings \ volume 1807 ,\ pages 020008 ( year 2017 ) ,\ http://arxiv.org/abs/https://...

    doi

  34. [42]

    \ Du , author X

    author author K.-z. \ Du , author X. Wang , author Q. Han , author Y. Yan , \ and\ author D. B. \ Mitzi ,\ title title Heterovalent b-site co-alloying approach for halide perovskite bandgap engineering , \ 10.1021/acsenergylett.7b00824 journal journal ACS Energy Letters \ volu...

    doi

  35. [43]

    Becker \ and\ author M

    author author M. Becker \ and\ author M. Wark ,\ title title Organic cation substitution in hybrid perovskite ch3nh3pbi3 with hydroxylammonium (nh3oh+): A first-principles study , \ 10.1021/acs.jpcc.7b10359 journal journal The Journal of Physical Chemistry C \ volume 122 ,\ pa...

    doi

  36. [44]

    author author M. T. \ Klug , author A. Osherov , author A. A. \ Haghighirad , author S. D. \ Stranks , author P. R. \ Brown , author S. Bai , author J. T.-W. \ Wang , author X. Dang , author V. Bulovic , author H. J. \ Snaith , \ and\ author A. M. \ Belcher ,\ title title Tail...

    doi

  37. [45]

    author author J. T.-W. \ Wang , author Z. Wang , author S. Pathak , author W. Zhang , author D. W. \ deQuilettes , author F. Wisnivesky-Rocca-Rivarola , author J. Huang , author P. K. \ Nayak , author J. B. \ Patel , author H. A. \ Mohd Yusof , author Y. Vaynzof , author R. Zh...

  38. [46]

    Hao , author C

    author author F. Hao , author C. C. \ Stoumpos , author R. P. H. \ Chang , \ and\ author M. G. \ Kanatzidis ,\ title title Anomalous band gap behavior in mixed sn and pb perovskites enables broadening of absorption spectrum in solar cells , \ 10.1021/ja5033259 journal journal ...

    doi

  39. [47]

    author author M. A. \ Mohebpour , author M. Saffari , author H. R. \ Soleimani , \ and\ author M. B. \ Tagani ,\ title title High performance of mixed halide perovskite solar cells: Role of halogen atom and plasmonic nanoparticles on the ideal current density of cell , \ https...

    doi

  40. [48]

    Xiao , author L

    author author Z. Xiao , author L. Zhao , author N. L. \ Tran , author Y. L. \ Lin , author S. H. \ Silver , author R. A. \ Kerner , author N. Yao , author A. Kahn , author G. D. \ Scholes , \ and\ author B. P. \ Rand ,\ title title Mixed-halide perovskites with stabilized band...

    doi

  41. [49]

    author author H. F. \ Zarick , author N. Soetan , author W. R. \ Erwin , \ and\ author R. Bardhan ,\ title title Mixed halide hybrid perovskites: a paradigm shift in photovoltaics , \ 10.1039/C7TA09122B journal journal J. Mater. Chem. A \ volume 6 ,\ pages 5507--5537 ( year 20...

    doi

  42. [50]

    Tombe , author G

    author author S. Tombe , author G. Adam , author H. Heilbrunner , author D. H. \ Apaydin , author C. Ulbricht , author N. S. \ Sariciftci , author C. J. \ Arendse , author E. Iwuoha , \ and\ author M. C. \ Scharber ,\ title title Optical and electronic properties of mixed hali...

    doi

  43. [51]

    Wang , author Y

    author author X. Wang , author Y. Ling , author X. Lian , author Y. Xin , author K. B. \ Dhungana , author F. Perez-Orive , author J. Knox , author Z. Chen , author Y. Zhou , author D. Beery , author K. Hanson , author J. Shi , author S. Lin , \ and\ author H. Gao ,\ title tit...

    doi

  44. [52]

    author author D. W. \ de Quilettes , author S. M. \ Vorpahl , author S. D. \ Stranks , author H. Nagaoka , author G. E. \ Eperon , author M. E. \ Ziffer , author H. J. \ Snaith , \ and\ author D. S. \ Ginger ,\ title title Impact of microstructure on local carrier lifetime in ...

    doi

  45. [53]

    author author E. T. \ Hoke , author D. J. \ Slotcavage , author E. R. \ Dohner , author A. R. \ Bowring , author H. I. \ Karunadasa , \ and\ author M. D. \ McGehee ,\ title title Reversible photo-induced trap formation in mixed-halide hybrid perovskites for photovoltaics , \ 1...

    doi

  46. [54]

    Wang , author S

    author author F. Wang , author S. Bai , author W. Tress , author A. Hagfeldt , \ and\ author F. Gao ,\ title title Defects engineering for high-performance perovskite solar cells , \ 10.1038/s41528-018-0035-z journal journal npj Flexible Electronics \ volume 2 ,\ pages 22 ( ye...

    doi

  47. [55]

    author author A. J. \ Barker , author A. Sadhanala , author F. Deschler , author M. Gandini , author S. P. \ Senanayak , author P. M. \ Pearce , author E. Mosconi , author A. J. \ Pearson , author Y. Wu , author A. R. \ Srimath Kandada , author T. Leijtens , author F. De Angel...

    doi

  48. [56]

    author author A. M. \ Ganose , author A. J. \ Jackson , \ and\ author D. O. \ Scanlon ,\ title title sumo: Command-line tools for plotting and analysis of periodic ab initio calculations , \ @noop journal journal Journal of Open Source Software \ volume 28 ,\ pages 717 ( year ...

    2018

  49. [57]

    author author K. X. \ Steirer , author P. Schulz , author G. Teeter , author V. Stevanovic , author M. Yang , author K. Zhu , \ and\ author J. J. \ Berry ,\ title title Defect tolerance in methylammonium lead triiodide perovskite , \ 10.1021/acsenergylett.6b00196 journal journ...

    doi

  50. [58]

    Berry , author T

    author author J. Berry , author T. Buonassisi , author D. A. \ Egger , author G. Hodes , author L. Kronik , author Y.-L. \ Loo , author I. Lubomirsky , author S. R. \ Marder , author Y. Mastai , author J. S. \ Miller , author D. B. \ Mitzi , author Y. Paz , author A. M. \ Rapp...

  51. [59]

    author author P. S. \ Whitfield , author N. Herron , author W. E. \ Guise , author K. Page , author Y. Q. \ Cheng , author I. Milas , \ and\ author M. K. \ Crawford ,\ title title Structures, phase transitions and tricritical behavior of the hybrid perovskite methyl ammonium l...

    doi

  52. [60]

    author author F. F. \ Targhi , author Y. S. \ Jalili , \ and\ author F. Kanjouri ,\ title title Mapbi3 and fapbi3 perovskites as solar cells: Case study on structural, electrical and optical properties , \ https://doi.org/10.1016/j.rinp.2018.07.007 journal journal Results in P...

    doi

  53. [61]

    Comin , author G

    author author R. Comin , author G. Walters , author E. S. \ Thibau , author O. Voznyy , author Z.-H. \ Lu , \ and\ author E. H. \ Sargent ,\ title title Structural , optical , and electronic studies of wide-bandgap lead halide perovskites , \ 10.1039/C5TC01718A journal journal...

    doi

  54. [62]

    Lehmann , author A

    author author F. Lehmann , author A. Franz , author D. M. \ Többens , author S. Levcenco , author T. Unold , author A. Taubert , \ and\ author S. Schorr ,\ title title The phase diagram of a mixed halide (br , i) hybrid perovskite obtained by synchrotron x-ray diffraction , \ ...

    doi

  55. [63]

    Gil-Escrig , author A

    author author L. Gil-Escrig , author A. Miquel-Sempere , author M. Sessolo , \ and\ author H. J. \ Bolink ,\ title title Mixed iodide–bromide methylammonium lead perovskite-based diodes for light emission and photovoltaics , \ 10.1021/acs.jpclett.5b01716 journal journal The Jo...

    doi

  56. [64]

    Maculan , author A

    author author G. Maculan , author A. D. \ Sheikh , author A. L. \ Abdelhady , author M. I. \ Saidaminov , author M. A. \ Haque , author B. Murali , author E. Alarousu , author O. F. \ Mohammed , author T. Wu , \ and\ author O. M. \ Bakr ,\ title title Ch3nh3pbcl3 single crysta...

    doi

  57. [65]

    \ Wei , author L

    author author S.-H. \ Wei , author L. G. \ Ferreira , author J. E. \ Bernard , \ and\ author A. Zunger ,\ title title Electronic properties of random alloys: Special quasirandom structures , \ 10.1103/PhysRevB.42.9622 journal journal Phys. Rev. B \ volume 42 ,\ pages 9622--964...

    doi

  58. [66]

    Jiang , author Y

    author author Z. Jiang , author Y. Nahas , author B. Xu , author S. Prosandeev , author D. Wang , \ and\ author L. Bellaiche ,\ title title Special quasirandom structures for perovskite solid solutions , \ 10.1088/0953-8984/28/47/475901 journal journal Journal of Physics: Cond...

    doi

  59. [67]

    Heyd , author J

    author author J. Heyd , author J. E. \ Peralta , author G. E. \ Scuseria , \ and\ author R. L. \ Martin ,\ title title Energy band gaps and lattice parameters evaluated with the heyd-scuseria-ernzerhof screened hybrid functional , \ 10.1063/1.2085170 journal journal The Journa...

    doi

  60. [68]

    Aryasetiawan \ and\ author O

    author author F. Aryasetiawan \ and\ author O. Gunnarsson ,\ title title TheGWmethod , \ 10.1088/0034-4885/61/3/002 journal journal Reports on Progress in Physics \ volume 61 ,\ pages 237--312 ( year 1998 ) NoStop

    1998 doi

  61. [69]

    Sun , author M

    author author R. Sun , author M. K. Y. \ Chan , author S. Kang , \ and\ author G. Ceder ,\ title title Intrinsic stoichiometry and oxygen-induced p -type conductivity of pyrite fes _ 2 , \ 10.1103/PhysRevB.84.035212 journal journal Phys. Rev. B \ volume 84 ,\ pages 035212 ( ye...

    doi

  62. [70]

    author author E. M. \ Hutter , author G. E. \ Eperon , author S. D. \ Stranks , \ and\ author T. J. \ Savenije ,\ title title Charge carriers in planar and meso-structured organic–inorganic perovskites: Mobilities, lifetimes, and concentrations of trap states , \ 10.1021/acs.j...

    doi

  63. [71]

    Chen , author H

    author author Q. Chen , author H. Zhou , author Y. Fang , author A. Z. \ Stieg , author T.-B. \ Song , author H.-H. \ Wang , author X. Xu , author Y. Liu , author S. Lu , author J. You , author P. Sun , author J. McKay , author M. S. \ Goorsky , \ and\ author Y. Yang ,\ title ...

    doi

  64. [72]

    Kiermasch , author P

    author author D. Kiermasch , author P. Rieder , author K. Tvingstedt , author A. Baumann , \ and\ author V. Dyakonov ,\ title title Improved charge carrier lifetime in planar perovskite solar cells by bromine doping , \ https://doi.org/10.1038/srep39333 journal journal Scienti...

    doi

  65. [73]

    Chen , author B

    author author Z. Chen , author B. Turedi , author A. Y. \ Alsalloum , author C. Yang , author X. Zheng , author I. Gereige , author A. AlSaggaf , author O. F. \ Mohammed , \ and\ author O. M. \ Bakr ,\ title title Single-crystal mapbi3 perovskite solar cells exceeding 21\ effi...

    doi

  66. [74]

    Bi , author E

    author author Y. Bi , author E. M. \ Hutter , author Y. Fang , author Q. Dong , author J. Huang , \ and\ author T. J. \ Savenije ,\ title title Charge carrier lifetimes exceeding 15 μs in methylammonium lead iodide single crystals , \ 10.1021/acs.jpclett.6b00269 journal journa...

    doi

  67. [75]

    Anaya , author G

    author author M. Anaya , author G. Lozano , author M. E. \ Calvo , \ and\ author H. Míguez ,\ title title Abx3 perovskites for tandem solar cells , \ https://doi.org/10.1016/j.joule.2017.09.017 journal journal Joule \ volume 1 ,\ pages 769 -- 793 ( year 2017 ) NoStop

    2017 doi

  68. [76]

    Sadhanala , author S

    author author A. Sadhanala , author S. Ahmad , author B. Zhao , author N. Giesbrecht , author P. M. \ Pearce , author F. Deschler , author R. L. Z. \ Hoye , author K. C. \ Gödel , author T. Bein , author P. Docampo , author S. E. \ Dutton , author M. F. L. \ De Volder , \ and\...

    doi

  69. [77]

    Li , author X

    author author C. Li , author X. Lu , author W. Ding , author L. Feng , author Y. Gao , \ and\ author Z. Guo ,\ title title Formability of ABX 3 ( X = F, Cl, Br, I) halide perovskites , \ 10.1107/S0108768108032734 journal journal Acta Crystallographica Section B \ volume 64 ,\ ...

    doi

  70. [78]

    merlin.mbs apsrev4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked

    FUNCTION id.bst "merlin.mbs apsrev4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked" ENTRY address archive archivePrefix author bookaddress booktitle chapter collaboration doi edition editor eid eprint howpublished institution isbn issn journal key language month note number orga...

    2010

  71. [79]

    merlin.mbs apsrmp4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked

    FUNCTION id.bst "merlin.mbs apsrmp4-1.bst 2010-07-25 4.21a (PWD, AO, DPC) hacked" ENTRY address archive archivePrefix author bookaddress booktitle chapter collaboration doi edition editor eid eprint howpublished institution isbn issn journal key language month note number orga...

    2010

Pith tools

Reviewed August 14, 2026 · model on record in the stance chip above.