Pith. sign in

REVIEW 3 major objections 3 minor 15 references

Spectral determinant for the damped wave equation on an interval

T0 review · 3 major / 3 minor · reviewed 2026-08-14 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read The spectral determinant of the damped wave operator on an interval is independent of the damping and equals ±2T, with the sign determined by the branch of the logarithm.

desk verdict The claimed damping independence fails: for constant damping, first-order eigenvalue corrections make Det H = 2T e^{±aT}, not ±2T. read the letter →

arxiv 1908.06862 v1 pith:2NLUQXH2 submitted 2019-08-19 math-ph math.MPmath.SP

Pedro Freitas , Jiří Lipovský This is my paper · ORCID
classification math-phmath.MPmath.SP MSC 35L0534L20 PACS 46.40.Ff03.65.Ge
keywords spectraldeterminantdampedwaveequationzeta-functionregularizationnon-selfadjointoperatormatrix-coefficientdifferentialoperatorsbranchcutdependenceDirichletboundaryconditions
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper proves that for the damped wave equation $v_{tt}+2a(x)v_t=v_{xx}$ on an interval of length $T$ with Dirichlet boundary conditions, the zeta-regularized spectral determinant of the associated non-selfadjoint operator $H$ is independent of the damping $a(x)$: it equals $2T$ or $-2T$, depending only on which branch of the logarithm is used. This matters because it gives an exact statement about an infinite product of eigenvalues of a non-selfadjoint operator, and it shows that the determinant alone cannot recover any information about the damping. The proof does not require the eigenvalues themselves; it squares the operator, applies a general determinant formula for matrix-coefficient operators to $H^2$, and then transfers the result back through a comparison of zeta functions. A damped wave equation with an added potential is also treated, and there the determinant is again damping-independent, with a factor $2y(T)$ replacing $2T$.

What carries the argument

The carrying object is the squared operator $A=H^2$, whose leading coefficient is the nonsingular $2\times2$ matrix $a_2(x)=\begin{pmatrix}-1&0\\2a(x)&-1\end{pmatrix}$, so the general determinant formula for differential operators with matrix coefficients [BFK95] applies. The essential computation reduces that formula to $\det y_1(T)=T^2$, where $y_1(x)$ is the matrix solution of the Cauchy problem $y_1(0)=0$, $y_1'(0)=I$, yielding $\operatorname{Det} A=-4T^2$. A zeta-function comparison between $H$ and $A$ using $\zeta_H(s)-\zeta_A(s/2)=(e^{i\pi s}-1)(\cdots)$ then gives $\operatorname{Det} H=\pm i\sqrt{\operatorname{Det} A}=\pm2T$, with the branch of the logarithm selecting the sign.

What would settle it

Take $T=1$ and a concrete damping such as $a(x)=x$, compute the eigenvalues of the two-component operator $H$ numerically, and count the negative real eigenvalues; Theorem 2.1 requires this count to be even and requires the zeta-regularized determinant to be $2$ with the branch cut just above the negative real axis. An odd count, or a computed determinant different from $\pm 2$, would falsify the theorem.

Watch

Extended reading notes

Core claim

The central claim is Theorem 2.1: for $a(x)\in C([0,T])$ and a positive $\varepsilon$ with no eigenvalue of $H$ having phase in $[\pi-\varepsilon,\pi)$, the spectral determinant satisfies $\operatorname{Det} H=\pm 2T$, where the sign is $+2T$ for the branch cut $\lambda=t e^{i(\pi-\varepsilon)}$ and $-2T$ for the branch cut $\lambda=t e^{i(2\pi-\varepsilon)}$. In words, the zeta-regularized product of all eigenvalues of the damped wave operator depends only on the interval length, and all damping information cancels. The authors arrive at this by computing the determinant of the square operator exactly as $\operatorname{Det}(H^2)=-4T^2$ and using a zeta-function comparison to take the correct square root; the parity of the number of negative real eigenvalues of $H$ (asserted, not proved, to be even) is the only place a sign could have entered.

Load-bearing premise

The result depends on the assertion, made without proof after equation (6.1), that the operator $H$ always has an even number of negative real eigenvalues; if that parity ever failed, the determinant would change sign and Theorem 2.1's branch-to-sign correspondence would be wrong.

Editorial extensions

If this is right

  • For every continuous damping function $a(x)$, $\operatorname{Det} H$ is exactly $\pm 2T$, so the zeta-regularized eigenvalue product encodes only the interval length and the chosen branch of the logarithm.
  • The intermediate quantity $\operatorname{Det}(H^2)=-4T^2$ is exact and independent of $a(x)$, coming from $\det y_1(T)=T^2$ in the matrix-coefficient determinant formula.
  • With an added potential $b(x)$ whose operator has only negative eigenvalues, the determinant becomes $\pm 2y(T)$, where $y''+b(x)y=0$, $y(0)=0$, $y'(0)=1$, so damping-independence persists.
  • If the potential also has positive eigenvalues, the determinant acquires an extra sign factor $(-1)^{\operatorname{card} I_2}$, which can change the sign but not the magnitude or the damping-independence.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Editorial inference: the same square-and-formula strategy could carry over to metric graphs, where the necessary eigenvalue asymptotics are available; on a graph the determinant might factor over edges and remain damping-free, but the paper does not address this.
  • Editorial inference: the computation pins down the multiplicative anomaly for this operator class as $\operatorname{Det}(H^2)/(\operatorname{Det} H)^2=-1$ independent of $T$ and $a(x)$, giving a sharp test for numerical determinant computations.
  • Editorial inference: because the parity of negative real eigenvalues is the only possible source of an extra sign, a systematic numerical search for damping functions producing an odd count would either confirm the scope of Theorem 2.1 or expose a sign instability.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 3 minor

Summary. The paper studies the zeta-regularized spectral determinant of the damped wave operator H on an interval [0,T] with Dirichlet boundary conditions and continuous damping a(x). The main result, Theorem 2.1, claims that the determinant is independent of the damping and equals ±2T, with the sign determined by the branch cut of the logarithm. The proof proceeds by applying the Burghelea–Friedlander–Kappeler (BFK) determinant formula to H^2, obtaining Det A = -4T^2, and then relating the zeta functions of H and A through the identity ζ_H(s) - ζ_A(s/2) = 2i e^{iπs/2} sin(πs/2) (Σ_j e^{-s/2 log μ̄_j^2} + Σ_{j∈I2} e^{-s/2 log ω_j^2}). A limit argument is used to show the correction term vanishes, yielding ζ'_H(0) - ½ζ'_A(0) = iπ(card I2 - 1/2), and the parity of card I2 is asserted to be even, giving the final determinant.

Significance. The claimed result is striking: for a non-selfadjoint operator, the spectral determinant would depend only on the interval length and not on the damping, which would be a new and somewhat surprising phenomenon. The use of the BFK theorem is elegant and the computation of Det A = -4T^2 is explicit and transparent. However, the central claim is false; the error in the limit argument of Section 6 is load-bearing and cannot be repaired without changing the statement.

major comments (3)
  1. [§6, around Eq. (6.1)] The assertion that the 'last term is zero' immediately after Eq. (6.1) is false. For constant damping a(x)=a, the asymptotic expansion is μ̄_j^2 = -j^2π^2/T^2 (1 - 2iaT/(πj) + O(j^{-2})). With the chosen branch, -½ log μ̄_j^2 = -log(jπ/T) - iπ/2 + i aT/(πj) + O(j^{-2}). Hence the summand in the difference behaves as e^{-iπs/2}(T/π)^s j^{-s}(e^{i aT s/(πj)} - 1) ≈ e^{-iπs/2}(T/π)^s i aT s/(πj) j^{-s}. Summing over j gives, as s→0, the limit i aT/π, not 0. The bound in the paper replaces |e^{-s/2 log(1+O(1/j))}-1| by |e^{-sC}-1|, which drops the crucial 1/j factor. Correcting this adds a term -aT to ζ'_H(0) - ½ζ'_A(0), so the determinant becomes ±2T e^{±aT} (branch-dependent), contradicting Theorem 2.1 even for constant damping.
  2. [§6, after Eq. (6.1)] The statement 'The number of negative real eigenvalues card I2 is always even' is asserted without proof and is load-bearing for the sign of the determinant. Since Det H contains the factor e^{-iπ card I2}, any parity failure would change the sign and alter the branch-to-sign correspondence in Theorem 2.1. No argument or reference is provided, and Remark 6.2 itself shows that the analogous parity property can fail in related settings when positive eigenvalues of the potential operator are present.
  3. [§4–§5] Theorem 4.2 is stated for operators whose coefficients are 'in general smoothly dependent on x', and the BFK formula a priori requires smoothness assumptions on the matrix coefficients. Theorem 2.1 assumes only a(x) ∈ C([0,T]). The application to H^2 involves coefficients a(x) and a^2(x), so the paper either needs a smoothness assumption on a, an approximation argument, or an extension of the BFK theorem to continuous coefficients. As written, the determinant formula for H^2 is not justified in the stated generality.
minor comments (3)
  1. [Throughout] There are several typographical errors: 'perspecive', 'difficuly', 'ellaborate', 'satistfy' should be corrected in a revision.
  2. [§6, notation] The notation 'card I2' and 'card I_2' is used inconsistently; it should be typeset consistently, e.g., card I_2.
  3. [§6, Eq. (6.1) derivation] In the displayed derivation of ζ'_H(0) - ½ζ'_A(0), the factor 2i e^{iπs/2} sin(πs/2) is replaced by iπ in the limit; this step is correct only if the remaining sums have at most logarithmic growth as s→0, which is exactly the point that fails. The presentation would benefit from stating the required growth condition explicitly.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity found: the damping-independent determinant is derived from the BFK determinant formula and independent eigenvalue asymptotics, not assumed by construction.

full rationale

The central claim of Theorem 2.1 is not an input of the paper. The proof applies the Burghelea–Friedlander–Kappeler determinant formula to A = H^2, and the computation of Det A = -4T^2 is an explicit Cauchy-problem calculation: det y_1(T) = T^2 and K_theta = -4. No parameter is fitted, no determinant normalization is chosen to force the answer, and the value does not depend on a(x). The passage from Det A to Det H is made through an exact zeta-function identity, with the branch choices identified separately. The only substantial citation of prior work by an author is [BF09], which supplies eigenvalue asymptotics used to control a limit and to compute Im zeta'_A(0). That citation is independent evidence: [BF09] is a published theorem on eigenvalue asymptotics whose assumptions do not include the determinant result, so it is not a self-citation chain that smuggles in the conclusion. The unproved assertion that card I2 is always even is a gap, and the proof that the final limit vanishes is suspect (the constant-damping first-order correction may survive), but those are correctness concerns, not circularity. A flawed or unsupported limit is not an instance of a prediction reducing to its own inputs. There is no fitted-input-called-prediction, no uniqueness theorem imported from the authors, and no renaming of a known result. Accordingly, the circularity score is 0.

Assumptions & free parameters 0 free parameters · 4 assumptions · 0 invented entities

No free parameters or invented entities are introduced. The proof rests on the standard BFK theorem, prior eigenvalue asymptotics, and two unproved premises: the smoothness-to-continuity extension and the even parity of negative real eigenvalues.

assumptions (4)
  • standard math Burghelea-Friedlander-Kappeler determinant formula for matrix differential operators on an interval
    External theorem cited as [BFK95], used in Section 5 to compute Det(H^2) for the square of the damped wave operator.
  • domain assumption Eigenvalue asymptotics of the damped wave operator from [BF09]
    Cited prior result by the same authors, used in Section 6 to control limits in the zeta comparison and to identify the imaginary part of the zeta derivative.
  • ad hoc to paper The BFK theorem applies when the damping a(x) is only continuous
    BFK is stated for smooth coefficients in Section 4, while Theorem 2.1 assumes a in C([0,T]); no approximation argument is given.
  • ad hoc to paper Negative real eigenvalues of H occur in even number
    Asserted after Eq. (6.1) without proof; this parity is needed to fix the sign of the determinant.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Spectral determinant for the damped wave equation on an interval." pith.science (2026). https://pith.science/paper/2NLUQXH2

@misc{pith2026190806862,
  author       = {Pith},
  title        = {Pith review of: Spectral determinant for the damped wave equation on an interval},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/2NLUQXH2}},
  note         = {Machine review of arXiv:1908.06862}
}
abstract

We evaluate the spectral determinant for the damped wave equation on an interval of length $T$ with Dirichlet boundary conditions, proving that it does not depend on the damping. This is achieved by analysing the square of the damped wave operator using the general result by Burghelea, Friedlander, and Kappeler on the determinant for a differential operator with matrix coefficients.

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

15 extracted references · 11 canonical work pages

  1. [1]

    Akkermans, A

    E. Akkermans, A. Comtet, J. Desbois, G. Montambaux, C. Texier, Spectral determinant on quantum graphs, Annals of Physics 284 (2000), 10--51. DOI: 10.1006/aphy.2000.6056

    work page arXiv 2000

  2. [2]

    Borisov, P

    D. Borisov, P. Freitas, Eigenvalue asymptotics, inverse problems and a trace formula for the linear damped wave equation, J. Diff. Eq. 247 (2009), 3028--3039. DOI: 10.1016/j.jde.2009.07.029

    work page doi:10.1016/j.jde.2009.07.029 2009

  3. [3]

    Burghelea, L

    D. Burghelea, L. Friedlander, T. Kappeler, On the determinant of elliptic boundary value problems on a line segment, Proc. Amer. Math. Soc. 123 (1995), 3027--3038. DOI 10.2307/2160656

    work page doi:10.2307/2160656 1995

  4. [4]

    B\"ar, S

    C. B\"ar, S. Schopka, The Dirac Determinant of Spherical Space Forms, in Hildebrandt S., Karcher H. (eds), Geometric Analysis and Nonlinear Partial Differential Equations. Springer, Berlin, Heidelberg (2003). DOI: 10.1007/978-3-642-55627-2 \_ 3

    work page doi:10.1007/978-3-642-55627-2 2003

  5. [5]

    Chen, S.A

    G. Chen, S.A. Fulling, F.J. Narcowich, S. Sun, Exponential decay of energy of evolution equations with locally distributed damping, SIAM J. Appl. Math. 51 (1991), 266--301. DOI: 10.1137/0151015

    work page doi:10.1137/0151015 1991

  6. [6]

    S. Cox, E. Zuazua, The rate at which energy decays in a damped string, Comm. Partial Differential Equations 19 (1994) 213--243. DOI: 10.1080/03605309408821015

    work page doi:10.1080/03605309408821015 1994

  7. [7]

    G. V. Dunne, Functional determinants in quantum field theory, J. Phys. A: Math. Theor. 41 (2008) 304006. DOI: 10.1088/1751-8113/41/30/304006

    doi:10.1088/1751-8113/41/30/304006 2008

  8. [8]

    Freitas, J

    P. Freitas, J. Lipovsk\'y, Eigenvalue asymptotics for the damped wave equation on metric graphs, J. Diff. Eq. 263 (2017), 2780--2811. DOI: 10.1016/j.jde.2017.04.012

    work page doi:10.1016/j.jde.2017.04.012 2017

Show all 15 references
  1. [9]

    Friedlander, Determinant of the Schr\" o dinger operator on a metric graph

    L. Friedlander, Determinant of the Schr\" o dinger operator on a metric graph. Quantum graphs and their applications, 151--160, Contemp. Math. 415 , Amer. Math. Soc., Providence, RI, 2006. DOI: 10.1090/conm/415/07866

    2006 doi

  2. [10]

    Gelfand and A.M

    I.M. Gelfand and A.M. Yaglom, Integration in functional spaces and its applications in quantum physics, J. Math. Phys. 1 (1960), 48--69. DOI: 10.1063/1.1703636

    1960 doi

  3. [11]

    Gesztesy, H

    F. Gesztesy, H. Holden, The damped string problem revisited, J. Diff. Eq. 251 (2011) 1086--1127. DOI: 10.1016/j.jde.2011.04.025

    2011 doi

  4. [12]

    Levit, U

    S. Levit, U. Smilansky, A Theorem on Infinite Products of Eigenvalues of Sturm-Liouville Type Operators, Proc. Am. Math. Soc. 65 (1977), 299--302. DOI: 10.2307/2041911

    1977 doi

  5. [13]

    Minakshisundaram and

    S. Minakshisundaram and . Pleijel, Some properties of the eigenfunctions of the Laplace-operator on Riemannian manifolds, Can. J. Math. 1 (1949) 242--256. DOI: 10.4153/CJM-1949-021-5

    1949 doi

  6. [14]

    Ray and I.M

    D.B. Ray and I.M. Singer, R-torsion and the Laplacian on Riemannian manifolds, Adv. Math. 7 (1971), 145--210. DOI 10.1016/0001-8708(71)90045-4

    1971 doi

  7. [15]

    K. P. Wojciechowski, Heat equation and spectral geometry: Introduction for beginners, in H. Ocampo, S. Paycha, A. Reyes, Geometric Methods for Quantum Field Theory, World Scientific, pp. 238-292 (2001). DOI: 10.1142/9789812810571 \_ 0004

    2001 doi

Pith tools

Reviewed August 14, 2026 · model on record in the stance chip above.