Pith. sign in

REVIEW 3 major objections 3 minor 1 cited by

Evidence for neutron capture in heavy-metal hot subdwarfs: Far-UV spectroscopy of EC22536-5304 and LSIV-14 116

T0 review · 3 major / 3 minor · reviewed 2026-05-22 · grok-4.3

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read The Pb-rich subdwarf EC22536-5304 shows an abundance pattern matching i-process nucleosynthesis, indicating self-enrichment via neutron capture.

desk verdict The paper delivers first far-UV spectra and many new heavy-element detections in two hot subdwarfs, with one showing a pattern that lines up with i-process yields, though the quantitative match rests on untested atomic data. read the letter →

arxiv 2605.21772 v1 pith:2T224MYC submitted 2026-05-20 astro-ph.SR

M. Dorsch , C. S. Jeffery , J. Deprince , D. J. Dougan , S. Beauraind , H. Dupuis , T. Battich , P. Quinet
show 3 more authors
U. Heber L. J. A. Scott S. Geier
This is my paper · ORCID
classification astro-ph.SR
keywords hotsubdwarfsheavymetalenrichmenti-processnucleosynthesisUVspectroscopyabundanceanalysisneutroncapturestellarevolution
checked against Foundation.AbsoluteFloorClosureCost.FunctionalEquation
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper analyses the first far-ultraviolet spectra of two heavy-metal hot subdwarfs to measure abundances of many elements heavier than iron. The star EC22536-5304 reaches extreme overabundances that decline smoothly from strontium to bismuth in a way that matches the yields expected from the i-process. A reader would care because the pattern cannot be produced by diffusion or accretion alone and instead points to internal neutron-capture nucleosynthesis. The second star, LSIV-14 116, shows a different peak enrichment at lighter heavy elements, consistent with a separate formation path.

What carries the argument

i-process nucleosynthesis pattern, a sequence of neutron-capture yields at intermediate neutron densities that reproduces the observed heavy-element abundances in EC22536-5304.

What would settle it

If revised non-LTE models using different atomic data or including full diffusion produce abundances for EC22536-5304 that no longer align with i-process predictions, the claimed match would be ruled out.

Watch

Extended reading notes

Core claim

EC22536-5304 reaches 6.2 dex enrichment in lead and 5.4 dex in bismuth relative to solar values. Its full abundance pattern from strontium through bismuth closely reproduces the predictions of i-process nucleosynthesis. This match supplies direct evidence that the heavy metals were produced by neutron capture inside the star. LSIV-14 116 instead peaks near 4.3 dex for strontium to tin and declines toward lead and bismuth, consistent with a different nucleosynthetic history.

Load-bearing premise

The measured abundances reflect the star's nucleosynthetic history rather than being reshaped by atmospheric diffusion or other non-nuclear processes.

Editorial extensions

If this is right

  • The abundance patterns retain a clear nucleosynthetic signature that atomic diffusion alone cannot reproduce.
  • Heavy metals in other intermediate helium-rich sdOB stars are also likely self-synthesised.
  • EC22536-5304 probably formed through Roche-lobe overflow in a binary system.
  • LSIV-14 116 probably formed through the merger of two low-mass white dwarfs.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The same i-process self-enrichment may operate in other classes of evolved stars that experience mixing episodes.
  • The newly computed atomic data for As III, Se III, Hf IV, Tl IV and Pb ions can now be applied to UV spectra of additional hot stars.
  • Stellar evolution models for low-mass helium-burning stars may need to incorporate i-process channels when binary interaction is present.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

3 major / 3 minor

Summary. The manuscript presents far-UV spectroscopic analysis of two heavy-metal hot subdwarfs, LSIV-14 116 and EC22536-5304. It compiles atomic data, computes new oscillator strengths for several ions and photoionisation cross-sections for Pb, and uses non-LTE SYNSPEC models to derive abundances of light and heavy elements. The paper reports numerous first detections of heavy elements in these stars and concludes that the abundance pattern in EC22536-5304 closely matches i-process nucleosynthesis predictions, providing evidence for self-enrichment via neutron capture. Different formation channels are suggested for the two objects.

Significance. If the results hold, this paper would make a notable contribution to the field by offering direct evidence for i-process operation in hot subdwarfs, which are typically not associated with such nucleosynthesis. The first detections of elements such as Br, Nb, Mo, Pd, In, Sb, Te, Xe, La, Ce, Pr, Nd, Er, Yb, Lu, Hf, Ta, W, Os, Pt, Hg, Tl, and Bi in sdO/B stars are valuable additions to stellar abundance studies. The work also demonstrates the importance of updated atomic data for analyzing complex UV spectra.

major comments (3)
  1. [Atomic data compilation and calculations] The newly computed oscillator strengths for As III, Se III, Hf IV, and Tl IV, as well as the Pb III-VI photoionisation cross-sections, are critical for the non-LTE modeling and abundance derivations of the heavy elements. The manuscript does not include any external validation, laboratory comparisons, or sensitivity analyses for these data. This is a load-bearing issue because uncertainties of 0.3 dex or more in log gf values could significantly affect the reported Pb abundance of 6.2 dex and Bi of 5.4 dex, thereby impacting the claimed close match to i-process predictions.
  2. [Results and discussion for EC22536-5304] The statement that EC22536-5304 'closely matches predictions of i-process nucleosynthesis' is central to the paper's main conclusion. However, no quantitative measure of the fit (e.g., reduced chi-squared or element-by-element residuals with uncertainties) is provided, making it hard to evaluate how robust the match is against the derived abundance errors.
  3. [Abundance determination methods] The paper lacks a detailed error budget for the derived abundances, including contributions from atomic data uncertainties, model atmosphere assumptions, and line blending in the UV spectra. This omission makes it difficult to assess the reliability of the nucleosynthetic interpretation over alternative explanations like diffusion.
minor comments (3)
  1. [Abstract] The abstract could specify the wavelength range of the far-UV spectra analyzed for clarity.
  2. [Spectral figures] The spectral figures would benefit from annotations indicating which lines are from newly computed data versus literature values.
  3. [References] Ensure all relevant prior works on hot subdwarf abundances and i-process calculations are cited, particularly any recent studies on similar objects.

Simulated Author's Rebuttal

3 responses · 0 unresolved

We thank the referee for their thorough and constructive review of our manuscript. We address each major comment below and will incorporate revisions to strengthen the paper.

read point-by-point responses

  1. Referee: [Atomic data compilation and calculations] The newly computed oscillator strengths for As III, Se III, Hf IV, and Tl IV, as well as the Pb III-VI photoionisation cross-sections, are critical for the non-LTE modeling and abundance derivations of the heavy elements. The manuscript does not include any external validation, laboratory comparisons, or sensitivity analyses for these data. This is a load-bearing issue because uncertainties of 0.3 dex or more in log gf values could significantly affect the reported Pb abundance of 6.2 dex and Bi of 5.4 dex, thereby impacting the claimed close match to i-process predictions.

    Authors: We agree that the presentation of the new atomic data would benefit from additional discussion of validation and uncertainties. The oscillator strengths were computed using the Hartree-Fock method with relativistic corrections, and the Pb photoionisation cross-sections were obtained via the R-matrix approach; limited internal comparisons to existing theoretical values were performed during the work. To address the referee's concern, we will add a dedicated subsection describing the computational methods, any available literature comparisons, and a sensitivity analysis quantifying the impact of plausible variations in log gf values on the derived Pb and Bi abundances. revision: yes

  2. Referee: [Results and discussion for EC22536-5304] The statement that EC22536-5304 'closely matches predictions of i-process nucleosynthesis' is central to the paper's main conclusion. However, no quantitative measure of the fit (e.g., reduced chi-squared or element-by-element residuals with uncertainties) is provided, making it hard to evaluate how robust the match is against the derived abundance errors.

    Authors: We concur that a quantitative metric would improve the robustness of this central claim. We will add a quantitative assessment of the fit, including computation of a reduced chi-squared value between the observed abundances and i-process model predictions, together with element-by-element residuals plotted or tabulated with their estimated uncertainties. revision: yes

  3. Referee: [Abundance determination methods] The paper lacks a detailed error budget for the derived abundances, including contributions from atomic data uncertainties, model atmosphere assumptions, and line blending in the UV spectra. This omission makes it difficult to assess the reliability of the nucleosynthetic interpretation over alternative explanations like diffusion.

    Authors: We will expand the methods and discussion sections to provide a detailed error budget. This will explicitly include estimated contributions from uncertainties in the new atomic data, variations in adopted model atmosphere parameters (Teff, log g, and microturbulence), and the effects of line blending in the far-UV region. The revised text will also address how these uncertainties influence the distinction between nucleosynthetic signatures and diffusion scenarios. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: abundances derived from spectra and matched to external i-process predictions

full rationale

The paper computes new oscillator strengths for As III, Se III, Hf IV, Tl IV and Pb photoionisation cross-sections, inserts them into SYNSPEC to generate non-LTE models, extracts observed abundances for 26 heavy elements in EC22536-5304, and reports that the resulting pattern closely matches independent i-process nucleosynthesis yields from the literature. No equation or step reduces the reported match to a fitted parameter inside the paper, a self-citation chain, or a redefinition of the input data. The nucleosynthesis comparison is presented as an external test rather than an internal consistency condition, and the atomic-data computations are described as enabling the measurement rather than being tuned to produce the target pattern. The derivation chain therefore remains self-contained against external benchmarks.

Assumptions & free parameters 0 free parameters · 2 assumptions · 0 invented entities

The central claim rests on the accuracy of newly computed atomic data and on the assumption that the observed abundance pattern is dominated by nucleosynthesis rather than diffusion.

assumptions (2)
  • domain assumption Standard non-LTE assumptions in stellar-atmosphere modeling apply to these stars.
    Invoked for the SYNSPEC non-LTE models of multiply ionized Pb.
  • domain assumption Compiled literature energy levels and the new oscillator strengths accurately represent the true atomic transitions.
    Required to identify lines and derive abundances for ions absent from standard lists.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Evidence for neutron capture in heavy-metal hot subdwarfs: Far-UV spectroscopy of EC22536-5304 and LSIV-14 116." pith.science (2026). https://pith.science/paper/2T224MYC

@misc{pith2026260521772,
  author       = {Pith},
  title        = {Pith review of: Evidence for neutron capture in heavy-metal hot subdwarfs: Far-UV spectroscopy of EC22536-5304 and LSIV-14 116},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/2T224MYC}},
  note         = {Machine review of arXiv:2605.21772}
}
abstract

Most hot subdwarfs (sdO/B) are low-mass core-helium-burning stars formed through binary interaction. A subgroup of intermediate He-rich sdOBs shows extreme heavy-metal (Z>30) enrichments exceeding $10^4$ times solar, especially in Zr or Pb. We analyse the first ultraviolet spectra of the "heavy metal" subdwarfs LSIV-14 116 (Zr-rich) and EC22536-5304 (Pb-rich) to determine their abundance patterns and test nucleosynthesis models. Both stars show exceptionally rich heavy-element spectra dominated by ions in stages III-VI, many absent from standard line lists. We compiled literature energy levels, wavelengths, and oscillator strengths and implemented them in the SYNSPEC code. In addition, we computed new oscillator strengths for As III, Se III, Hf IV, and Tl IV. New photoionisation cross-sections for Pb III-VI enabled the first non-LTE models of multiply ionised Pb. In LSIV-14 116 we detect 16 light and 24 heavy metals (Ga-Bi); Br, Nb, Mo, Pd, In, Sb, Te, and Xe are measured in an sdO/B star for the first time. In EC22536-5304 13 light and 26 heavy metals are detected, including first detections of La, Ce, Pr, Nd, Er, Yb, Lu, Hf, Ta, W, Os, Pt, Hg, Tl, and Bi. LSIV-14 116 peaks at ~4.3 dex for Sr-Sn relative to solar, declining to 3.1 dex at Pb and 2.3 dex at Bi, whereas EC22536-5304 reaches 6.2 dex for Pb and 5.4 dex for Bi. Both stars are Fe-poor. The abundance patterns cannot be explained by atomic diffusion alone and retain a clear nucleosynthetic signature. EC22536-5304 closely matches predictions of i-process nucleosynthesis, providing strong evidence for i-process self-enrichment in hot subdwarfs. EC22536-5304 likely formed via Roche-lobe overflow, whereas LSIV-14 116 likely originated from the merger of two low-mass white dwarfs, which may explain differences in its enrichment pattern. These results suggest that heavy metals in other He-sdO/Bs may also be self-synthesised.

Figures

Figures reproduced from arXiv: 2605.21772 by the authors.

Figure 1
Figure 1. The strongest Ga, Ge, Se, Kr, Sr, Y, and Zr lines in the STIS [PITH_FULL_IMAGE:figures/full_fig_p005_1.png] view at source ↗
Figure 2
Figure 2. Top: the strongest Asiii-iv lines in LS IV−14◦116, with available oscillator strengths (see Fig. A.2 for Asiv lines with￾out). Bottom: similar for Br iv; note also Hg iv 1158.191 Å. See [PITH_FULL_IMAGE:figures/full_fig_p006_2.png] view at source ↗
Figure 3
Figure 3. Nb (Z = 41), Mo (42), Pd (46), Cd (48), In (49), Sn (50), Te (52), I (53), and Xe (54) lines in LS IV−14◦116, like [PITH_FULL_IMAGE:figures/full_fig_p008_3.png] view at source ↗
Figures from the paper (8 more)
Figure 4
Figure 4. Figure 4: Possible detection of Ag iv in LS IV−14◦116, like [PITH_FULL_IMAGE:figures/full_fig_p009_4.png]
Figure 5
Figure 5. Figure 5: Top: HFS splitting of Sb v 1226 Å in HD 127493, EC 22536−5304, and LS IV−14◦116. Split component wave￾lengths are indicated. The HFS splits are clearly resolved in HD 127493 because it was observed at R = 114 000. Bottom: the strongest Sb iv lines in LS IV−14◦116, like…
Figure 6
Figure 6. Figure 6: The strongest La iv lines in EC 22536−5304, like [PITH_FULL_IMAGE:figures/full_fig_p011_6.png]
Figure 7
Figure 7. Figure 7: Ce (Z = 58), Pr (59), Nd (60), Er (68), Yb (70), Lu (71), Hf (72), W (74), and Os (76) lines in EC 22536−5304, like [PITH_FULL_IMAGE:figures/full_fig_p012_7.png]
Figure 8
Figure 8. Figure 8: HFS-split Ta v lines in EC 22536−5304, similar to [PITH_FULL_IMAGE:figures/full_fig_p014_8.png]
Figure 10
Figure 10. Figure 10: The strongest Hg iv-v, Tl iv, Pb iii-vi, and Bi iii-v lines, next to Sn iv, in the STIS spectrum of EC 22536−5304; like [PITH_FULL_IMAGE:figures/full_fig_p015_10.png]
Figure 11
Figure 11. Figure 11: Top: Surface abundances of EC 22536−5304 and LS IV−14◦116 by number, compared to the solar pattern of Asplund et al. (2009), supplemented with heavy-metal results from Grevesse et al. (2015), Lodders (2019), and Asplund et al. (2021). Middle: Abundances relative to so…
Figure 12
Figure 12. Figure 12: Convection test for LS IV−14◦116 (red) and EC 22536- −5304 (blue). Top: Adiabatic gradients (solid), computed fol￾lowing Groth et al. (1985), compared with the Tlusty model gra￾dients (dashed); shaded regions indicate layers unstable accord￾ing to the Schwarzschild cr…

Discussion (0). Continue with ORCID to comment.

Lean theorems connected to this paper

Citations machine-checked in the Pith Canon. Every link opens the source theorem in the public Lean library.

What do these tags mean?
matches
The paper's claim is directly supported by a theorem in the formal canon.
supports
The theorem supports part of the paper's argument, but the paper may add assumptions or extra steps.
extends
The paper goes beyond the formal theorem; the theorem is a base layer rather than the whole result.
uses
The paper appears to rely on the theorem as machinery.
contradicts
The paper's claim conflicts with a theorem or certificate in the canon.
unclear
Pith found a possible connection, but the passage is too broad, indirect, or ambiguous to say the theorem truly supports the claim.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Stellar heavy-element slope index

    astro-ph.SR 2026-07 conditional novelty 4.0 of 10

    Heavy-element abundance patterns in stars can be summarized by a single slope d_Z from a linear fit of [Z/H] versus atomic number, but the connection to freeze-out conditions is not yet derived.

Reference graph

Works this paper leans on

208 extracted references · 208 canonical work pages · cited by 1 Pith paper

  1. [1]

    & Reader, J

    Acquista, N. & Reader, J. 1980, Journal of the Optical Society of America (1917- 1983), 70, 789

    work page 1980

  2. [2]

    & Colón, C

    Alonso-Medina, A. & Colón, C. 2012, MNRAS, 427, 1312

    work page 2012

  3. [3]

    2011, Atomic Data and Nuclear Data Tables, 97, 36

    Alonso-Medina, A., Colón, C., & Porcher, P. 2011, Atomic Data and Nuclear Data Tables, 97, 36

    work page 2011

  4. [4]

    2009, MNRAS, 395, 567

    Alonso-Medina, A., Colón, C., & Zanón, A. 2009, MNRAS, 395, 567

    work page 2009

  5. [5]

    & Lindgard, A

    Andersen, T. & Lindgard, A. 1977, Journal of Physics B Atomic Molecular Physics, 10, 2359

    work page 1977

  6. [6]

    & Tauheed, A

    Ankita, S. & Tauheed, A. 2020, J. Quant. Spectr. Rad. Transf., 254, 107193

    work page 2020

  7. [7]

    H., Tauheed, A., & Kernahan, J

    Ansbacher, W., Pinnington, E. H., Tauheed, A., & Kernahan, J. A. 1991, Journal of Physics B Atomic Molecular Physics, 24, 587

    work page 1991

  8. [8]

    C., Christlieb, N., et al

    Aoki, W., Beers, T. C., Christlieb, N., et al. 2007, ApJ, 655, 492

    work page 2007

Show all 208 references
  1. [9]

    1930, Nature, 126, 565

    Arvidsson, G. 1930, Nature, 126, 565

    1930

  2. [10]

    Arya, N. K. & Tauheed, A. 2020, J. Quant. Spectr. Rad. Transf., 255, 107253

    2020

  3. [11]

    Arya, N. K. & Tauheed, A. 2022, J. Quant. Spectr. Rad. Transf., 292, 108353

    2022

  4. [12]

    Arya, N. K. & Tauheed, A. 2023, European Physical Journal D, 77, 150

    2023

  5. [13]

    M., & Grevesse, N

    Asplund, M., Amarsi, A. M., & Grevesse, N. 2021, A&A, 653, A141

    2021

  6. [14]

    J., & Scott, P

    Asplund, M., Grevesse, N., Sauval, A. J., & Scott, P. 2009, ARA&A, 47, 481

    2009

  7. [15]

    I., Raassen, A

    Azarov, V . I., Raassen, A. J. J., Joshi, Y . N., Uylings, P. H. M., & Ryabtsev, A. N. 1997, Phys. Scr, 56, 325

    1997

  8. [16]

    I., Raassen, A

    Azarov, V . I., Raassen, A. J. J., Wyart, J. F., Joshi, Y . N., & Churilov, S. S. 2000, Phys. Scr, 61, 133

    2000

  9. [17]

    L., Pinnington, E

    Bahr, J. L., Pinnington, E. H., Kernahan, J. A., & O’Neill, J. A. 1982, Canadian Journal of Physics, 60, 1108

    1982

  10. [18]

    M., Córsico, A

    Battich, T., Miller Bertolami, M. M., Córsico, A. H., & Althaus, L. G. 2018, A&A, 614, A136

    2018

  11. [19]

    M., Serenelli, A

    Battich, T., Miller Bertolami, M. M., Serenelli, A. M., Justham, S., & Weiss, A. 2023, A&A, 680, L13

    2023

  12. [20]

    M., Weiss, A., et al

    Battich, T., Miller Bertolami, M. M., Weiss, A., et al. 2025, A&A, 699, A298

    2025

  13. [21]

    A., Romano, P., & Pradhan, A

    Bautista, M. A., Romano, P., & Pradhan, A. K. 1998, ApJS, 118, 259

    1998

  14. [22]

    Beck, D. R. & Datta, D. 1991, Phys. Rev. A, 44, 758

    1991

  15. [23]

    P., Chayer, P., Wesemael, F., et al

    Blanchette, J. P., Chayer, P., Wesemael, F., et al. 2008, ApJ, 678, 1329

    2008

  16. [24]

    1995, A&AS, 110, 441

    Bonifacio, P., Castelli, F., & Hack, M. 1995, A&AS, 110, 441

    1995

  17. [25]

    A., & Lugaro, M

    Brauner, M., Pignatari, M., Masseron, T., García-Hernández, D. A., & Lugaro, M. 2024, A&A, 690, A262

    2024

  18. [26]

    M., Burbidge, G

    Burbidge, E. M., Burbidge, G. R., Fowler, W. A., & Hoyle, F. 1957, Reviews of Modern Physics, 29, 547

    1957

  19. [27]

    Burke, P. G. 2011, R-Matrix Theory of Atomic Collisions, V ol. 61

    2011

  20. [28]

    Busso, M., Gallino, R., & Wasserburg, G. J. 1999, ARA&A, 37, 239

    1999

  21. [29]

    M., Jeffery, C

    Byrne, C. M., Jeffery, C. S., Tout, C. A., & Hu, H. 2018, MNRAS, 475, 4728

    2018

  22. [30]

    W., Lugaro, M., & Karakas, A

    Campbell, S. W., Lugaro, M., & Karakas, A. I. 2010, A&A, 522, L6 Carvajal Gallego, H., Deprince, J., Berengut, J. C., Palmeri, P., & Quinet, P. 2023, MNRAS, 518, 332 Carvajal Gallego, H., Palmeri, P., & Quinet, P. 2021, MNRAS, 501, 1440

    2010

  23. [31]

    1997, A&A, 321, 254

    Castelli, F., Parthasarathy, M., & Hack, M. 1997, A&A, 321, 254

    1997

  24. [32]

    2006, Baltic Astronomy, 15, 131

    Chayer, P., Fontaine, M., Fontaine, G., Wesemael, F., & Dupuis, J. 2006, Baltic Astronomy, 15, 131

    2006

  25. [33]

    2023, MN- RAS, 518, 368

    Chayer, P., Mendoza, C., Meléndez, M., Deprince, J., & Dupuis, J. 2023, MN- RAS, 518, 368

    2023

  26. [34]

    Chayer, P., Vennes, S., Dupuis, J., & Kruk, J. W. 2005, ApJ, 630, L169

    2005

  27. [35]

    Chikh, A., Deghiche, D., Meftah, A., et al. 2021, J. Quant. Spectr. Rad. Transf., 272, 107796 Article number, page 22 of 30 M. Dorsch et al.: Evidence for neutron capture in heavy-metal hot subdwarfs

    2021

  28. [36]

    Churilov, S. S. & Joshi, Y . N. 1996, Journal of the Optical Society of America B Optical Physics, 13, 11

    1996

  29. [37]

    S., Kildiyarova, R

    Churilov, S. S., Kildiyarova, R. R., & Joshi, Y . N. 1996, Canadian Journal of Physics, 74, 145 Colón, C. & Alonso-Medina, A. 2010, Journal of Physics B Atomic Molecular Physics, 43, 165001 Colón, C., Alonso-Medina, A., & Porcher, P. 2014, Atomic Data and Nuclear Data Tables, 100, 272

    1996

  30. [38]

    Cowan, R. D. 1973, Nuclear Instruments and Methods, 110, 173

    1973

  31. [39]

    Cowan, R. D. 1981, The theory of atomic structure and spectra

    1981

  32. [40]

    Crooker, A. M. & Joshi, Y . N. 1964, Journal of the Optical Society of America (1917-1983), 54, 553

    1964

  33. [41]

    2019, MNRAS, 488, 2503

    Cunningham, T., Tremblay, P.-E., Freytag, B., Ludwig, H.-G., & Koester, D. 2019, MNRAS, 488, 2503

    2019

  34. [42]

    Curtis, L. J. 1992, Journal of the Optical Society of America B Optical Physics, 9, 5

    1992

  35. [43]

    2026, arXiv e-prints, arXiv:2601.02250

    Dawson, H., Dorsch, M., Geier, S., et al. 2026, arXiv e-prints, arXiv:2601.02250

    2026

  36. [44]

    2024, A&A, 686, A25 de Andrés-García, I., Alonso-Medina, A., & Colón, C

    Dawson, H., Geier, S., Heber, U., et al. 2024, A&A, 686, A25 de Andrés-García, I., Alonso-Medina, A., & Colón, C. 2016, MNRAS, 455, 1145 de Andrés-García, I., Colón-Ruiz, C., & Colón, C. 2019, ApJ, 870, 131 De Smedt, K., Van Winckel, H., Kamath, D., et al. 2016, A&A, 587, A6

    2024

  37. [45]

    2024, PhD thesis, Friedrich Alexander University of Erlangen-

    Dorsch, M. 2024, PhD thesis, Friedrich Alexander University of Erlangen-

    2024

  38. [46]

    S., & Scott, L

    Dorsch, M., Heber, U., Jeffery, C. S., & Scott, L. 2022, From atomic physics to stellar evolution: decoding the heavy-metal subdwarfs with HST, HST Pro- posal. Cycle 30, ID. #17072

    2022

  39. [47]

    S., Irrgang, A., Woolf, V ., & Heber, U

    Dorsch, M., Jeffery, C. S., Irrgang, A., Woolf, V ., & Heber, U. 2021, A&A, 653, A120

    2021

  40. [48]

    2019, A&A, 630, A130

    Dorsch, M., Latour, M., & Heber, U. 2019, A&A, 630, A130

    2019

  41. [49]

    2020, A&A, 643, A22

    Dorsch, M., Latour, M., Heber, U., et al. 2020, A&A, 643, A22

    2020

  42. [50]

    J., Dorsch, M., Scott, L

    Dougan, D. J., Dorsch, M., Scott, L. J. A., et al. 2025, MNRAS, 544, 4353

    2025

  43. [51]

    Dutta, N. N. & Majumder, S. 2011, ApJ, 737, 25

    2011

  44. [52]

    N., Roy, S., Dixit, G., & Majumder, S

    Dutta, N. N., Roy, S., Dixit, G., & Majumder, S. 2013, Phys. Rev. A, 87, 012501

    2013

  45. [53]

    G., Grant, I

    Dyall, K. G., Grant, I. P., Johnson, C. T., Parpia, F. A., & Plummer, E. P. 1989, Computer Physics Communications, 55, 425

    1989

  46. [54]

    A., Safronova, U

    Dzuba, V . A., Safronova, U. I., & Johnson, W. R. 2003, Phys. Rev. A, 68, 032503

    2003

  47. [55]

    2013, Journal of Physics B Atomic Molecular Physics, 46, 095001

    Ekman, J., Grumer, J., Hartman, H., & Jönsson, P. 2013, Journal of Physics B Atomic Molecular Physics, 46, 095001

    2013

  48. [56]

    2021, MNRAS, 503, 5730

    Elabidi, H. 2021, MNRAS, 503, 5730

    2021

  49. [57]

    S., Belhadj, W., & Hamdi, R

    Elabidi, H., Sahal-Bréchot, S., Dimitrijevi ´c, M. S., Belhadj, W., & Hamdi, R. 2023, MNRAS, 522, 819

    2023

  50. [58]

    Elias, L. R. 1972, PhD thesis, University of Wisconsin, Madison Enzonga Yoca, S., Palmeri, P., Quinet, P., Jumet, G., & Biémont, É. 2012a, Jour- nal of Physics B Atomic Molecular Physics, 45, 035002 Enzonga Yoca, S. & Quinet, P. 2013, Journal of Physics B Atomic Molecular Phys...

    1972

  51. [59]

    Epstein, G. L. & Reader, J. 1976, Journal of the Optical Society of America (1917-1983), 66, 590

    1976

  52. [60]

    Epstein, G. L. & Reader, J. 1979, Journal of the Optical Society of America (1917-1983), 69, 511

    1979

  53. [61]

    1930, Zeitschrift fur Physik, 60, 320 Fernández-Menchero, L., Jeffery, C

    Fermi, E. 1930, Zeitschrift fur Physik, 60, 320 Fernández-Menchero, L., Jeffery, C. S., Ramsbottom, C. A., & Ballance, C. P. 2020, MNRAS, 496, 2558

    1930

  54. [62]

    2006, Journal of Physics : B Atomic Molecular and Optical Physics, 39

    Fivet, V ., Quinet, P., Biémont, E., & Xu, H.-L. 2006, Journal of Physics : B Atomic Molecular and Optical Physics, 39

    2006

  55. [63]

    & Chayer, P

    Fontaine, G. & Chayer, P. 1997, in The Third Conference on Faint Blue Stars, ed. A. G. D. Philip, J. Liebert, R. Saffer, & D. S. Hayes, 169

    1997

  56. [64]

    & Saxena, K

    Fraga, S. & Saxena, K. 1976, Handbook of Atomic Data (Elsevier Amsterdam)

    1976

  57. [65]

    1996, A&A, 313, 497

    Freytag, B., Ludwig, H.-G., & Steffen, M. 1996, A&A, 313, 497

    1996

  58. [66]

    Gautam, M. S. & Joshi, Y . N. 1972, Canadian Journal of Physics, 50, 2059

    1972

  59. [67]

    N., Raassen, A

    Gayasov, R., Joshi, Y . N., Raassen, A. J. J., & Kaufman, V . 2000, Phys. Scr, 61, 164

    2000

  60. [68]

    Grevesse, N., Scott, P., Asplund, M., & Sauval, A. J. 2015, A&A, 573, A27

    2015

  61. [69]

    G., Kudritzki, R

    Groth, H. G., Kudritzki, R. P., & Heber, U. 1985, A&A, 152, 107

    1985

  62. [70]

    1969, PhD thesis, University of British Columbia

    Gutmann, F. 1969, PhD thesis, University of British Columbia

    1969

  63. [71]

    S., & Sahal-Bréchot, S

    Hamdi, R., Ben Nessib, N., Dimitrijevi´c, M. S., & Sahal-Bréchot, S. 2013, MN- RAS, 431, 1039

    2013

  64. [72]

    J., Lugaro, M., & Meyer, B

    Hampel, M., Stancliffe, R. J., Lugaro, M., & Meyer, B. S. 2016, ApJ, 831, 171

    2016

  65. [73]

    Han, Z., Podsiadlowski, P., Maxted, P. F. L., Marsh, T. R., & Ivanova, N. 2002, MNRAS, 336, 449

    2002

  66. [74]

    & Tauheed, A

    Haris, K. & Tauheed, A. 2012, Phys. Scr, 85, 055301

    2012

  67. [75]

    2009, ARA&A, 47, 211

    Heber, U. 2009, ARA&A, 47, 211

    2009

  68. [76]

    2016, PASP, 128, 082001

    Heber, U. 2016, PASP, 128, 082001

    2016

  69. [77]

    2024, arXiv e-prints, arXiv:2410.11663

    Heber, U. 2024, arXiv e-prints, arXiv:2410.11663

    2024

  70. [78]

    R., et al

    Herwig, F., Pignatari, M., Woodward, P. R., et al. 2011, ApJ, 727, 89

    2011

  71. [79]

    R., Lin, P.-H., Knox, M., & Fryer, C

    Herwig, F., Woodward, P. R., Lin, P.-H., Knox, M., & Fryer, C. 2014, ApJ, 792, L3

    2014

  72. [80]

    M., Beers, T

    Holmbeck, E. M., Beers, T. C., Roederer, I. U., et al. 2018, ApJ, 859, L24

    2018

  73. [81]

    A., Glebbeek, E., & Dupret, M

    Hu, H., Tout, C. A., Glebbeek, E., & Dupret, M. A. 2011, MNRAS, 418, 195

    2011

  74. [82]

    & Lanz, T

    Hubeny, I. & Lanz, T. 2017, arXiv e-prints, arXiv:1706.01859

    2017 arXiv

  75. [83]

    1976, ApJ, 208, 165

    Iben, Jr., I. 1976, ApJ, 208, 165

    1976

  76. [84]

    2014, A&A, 565, A63

    Irrgang, A., Przybilla, N., Heber, U., et al. 2014, A&A, 565, A63

    2014

  77. [85]

    & Tauheed, A

    Jabeen, S. & Tauheed, A. 2015, J. Quant. Spectr. Rad. Transf., 154, 9

    2015

  78. [86]

    S., Ahmad, A., Naslim, N., & Kerzendorf, W

    Jeffery, C. S., Ahmad, A., Naslim, N., & Kerzendorf, W. 2015, MNRAS, 446, 1889

    2015

  79. [87]

    S., Baran, A

    Jeffery, C. S., Baran, A. S., Behara, N. T., et al. 2017, MNRAS, 465, 3101

    2017

  80. [88]

    Jeffery, C. S. & Miszalski, B. 2019, MNRAS, 489, 1481

    2019

  81. [89]

    1983, Atomic Data Nuclear Data Tables, 28, 333 Jönsson, P., Gaigalas, G., Biero´n, J., Fischer, C

    Johnson, W., Kolb, D., & Huang, K. 1983, Atomic Data Nuclear Data Tables, 28, 333 Jönsson, P., Gaigalas, G., Biero´n, J., Fischer, C. F., & Grant, I. P. 2013, Computer Physics Communications, 184, 2197 Jönsson, P., Verdebout, S., & Gaigalas, G. 2012, Journal of Physics B Atomi...

    1983

  82. [90]

    Jorissen, A., Boffin, H. M. J., Karinkuzhi, D., et al. 2019, A&A, 626, A127

    2019

  83. [91]

    Joshi, Y . N. & Kleef, T. A. M. V . 1986, Canadian Journal of Physics, 64, 330

    1986

  84. [92]

    Joshi, Y . N. & Raassen, A. J. J. 1990, Canadian Journal of Physics, 68, 195

    1990

  85. [94]

    N., Raassen, A

    Joshi, Y . N., Raassen, A. J. J., & Valk, A. A. V . d. 1990, Canadian Journal of Physics, 68, 284

    1990

  86. [95]

    N., Van Kleef, T

    Joshi, Y . N., Van Kleef, T. A. M., & Uylings, P. 1986, Physics Letters A, 113, 479

    1986

  87. [96]

    N., van Kleef, T

    Joshi, Y . N., van Kleef, T. A. M. v., & Mazzoni, M. 1980, Canadian Journal of Physics, 58, 737 Karaçoban Usta, B. & Eser, S. 2020a, Acta Physica Polonica A, 137, 1187 Karaçoban Usta, B. & Eser, S. 2020b, Acta Physica Polonica A, 137, S1

    1980

  88. [97]

    2021, A&A, 645, A61

    Karinkuzhi, D., Van Eck, S., Goriely, S., et al. 2021, A&A, 645, A61

    2021

  89. [98]

    & Sugar, J

    Kaufman, V . & Sugar, J. 1967, J. Res. Natl. Bur. Stand. (U.S.), Sect. A, 71, 583

    1967

  90. [99]

    & Sugar, J

    Kaufman, V . & Sugar, J. 1978, Journal of the Optical Society of America (1917- 1983), 68, 1529

    1978

  91. [100]

    Kaur, M., Nakra, R., Arora, B., Li, C.-B., & Sahoo, B. K. 2020, Journal of Physics B Atomic Molecular Physics, 53, 065002

    2020

  92. [101]

    Kelly, R. L. 1987, Journal of Physical and Chemical Reference Data, 17

    1987

  93. [102]

    Kielkopf, J. F. & Crosswhite, H. M. 1970, Journal of the Optical Society of America (1917-1983), 60, 347

    1970

  94. [103]

    R., Churilov, S

    Kildiyarova, R. R., Churilov, S. S., Joshi, Y . N., & Ryabtsev, A. N. 1996, Phys. Scr, 53, 454

    1996

  95. [104]

    R., van der Valk, A

    Kildiyarova, R. R., van der Valk, A. A., & Joshi, Y . N. 1995, Phys. Scr, 52, 522 Kitovien˙e, L., Gaigalas, G., Rynkun, P., Tanaka, M., & Kato, D. 2024, Journal of Physical and Chemical Reference Data, 53, 033101

    1995

  96. [105]

    1961, Physica, 27, 1177

    Klinkenberg, P., Van Kleef, T., & Noorman, P. 1961, Physica, 27, 1177

    1961

  97. [106]

    Ralchenko, Reader, J., & and NIST ASD Team

    Kramida, A., Yu. Ralchenko, Reader, J., & and NIST ASD Team. 2024, NIST Atomic Spectra Database (ver. 5.12), [Online]. Available: https://physics.nist.gov/asd[2025, May 3]. National Institute of Standards and Technology, Gaithersburg, MD. Krtiˇcka, J., Kubát, J., & Krtiˇcková,...

    2024

  98. [107]

    Kurucz, R. L. 1993, SYNTHE spectrum synthesis programs and line data

    1993

  99. [108]

    Kurucz, R. L. 1996, in Astronomical Society of the Pacific Conference Series, V ol. 108, M.A.S.S., Model Atmospheres and Spectrum Synthesis, ed. S. J

    1996

  100. [109]

    Kurucz, R. L. 2018, in Astronomical Society of the Pacific Conference Series, V ol. 515, Workshop on Astrophysical Opacities, 47

    2018

  101. [110]

    Lang, R. J. 1928, Physical Review, 32, 737

    1928

  102. [111]

    2019, A&A, 629, A148 Löbling, L., Maney, M

    Latour, M., Dorsch, M., & Heber, U. 2019, A&A, 629, A148 Löbling, L., Maney, M. A., Rauch, T., et al. 2020, MNRAS, 492, 528

    2019

  103. [112]

    2019, arXiv e-prints, arXiv:1912.00844

    Lodders, K. 2019, arXiv e-prints, arXiv:1912.00844

    2019

  104. [113]

    Loginov, A. V . & Tuchkin, V . I. 2001, Optics and Spectroscopy, 91, 165

    2001

  105. [114]

    Lyall, K. R. 1965, PhD thesis, University of British Columbia

    1965

  106. [115]

    2022, Atoms, 10, 130

    Maison, L., Carvajal Gallego, H., & Quinet, P. 2022, Atoms, 10, 130

    2022

  107. [116]

    Majlinger, Z., Simi´c, Z., & Dimitrijevi´c, M. S. 2017, MNRAS, 470, 1911

    2017

  108. [117]

    & Migdalek, J

    Marcinek, R. & Migdalek, J. 1994, Journal of Physics B Atomic Molecular Physics, 27, 5587

    1994

  109. [118]

    C., Zalubas, R., & Hagan, L

    Martin, W. C., Zalubas, R., & Hagan, L. 1978, Atomic energy levels - The rare- Earth elements

    1978

  110. [119]

    2024, A&A, 684, A8

    Martinet, S., Choplin, A., Goriely, S., & Siess, L. 2024, A&A, 684, A8

    2024

  111. [120]

    Maxted, P. F. L., Heber, U., Marsh, T. R., & North, R. C. 2001, MNRAS, 326, 1391

    2001

  112. [121]

    Meftah, A., Wyart, J.-F., Champion, N., & Tchang-Brillet, W.-Ü. L. 2007, Euro- pean Physical Journal D, 44, 35

    2007

  113. [122]

    2008, Phys

    Meftah, A., Wyart, J.-F., Sinzelle, J., et al. 2008, Phys. Scr, 77, 055302

    2008

  114. [123]

    L., Blaess, C., & Champion, N

    Meftah, A., Wyart, J.-F., Tchang-Brillet, W.-Ü. L., Blaess, C., & Champion, N. 2013, Phys. Scr, 88, 045305

    2013

  115. [124]

    Meijer, F. G. & Klinkenberg, P. F. A. 1973, Physica, 69, 111 Article number, page 23 of 30 A&A proofs:manuscript no. hst_heavy

    1973

  116. [125]

    Meijer, F. G. & Metsch, B. C. 1978, Physica B+C, 94, 259

    1978

  117. [126]

    Merrill, P. W. 1952, ApJ, 116, 21

    1952

  118. [127]

    P., Paprocki, M., et al

    Meurer, A., Smith, C. P., Paprocki, M., et al. 2017, PeerJ Computer Science, 3, e103

    2017

  119. [128]

    2015, Atomic Diffusion in Stars

    Michaud, G., Alecian, G., & Richer, J. 2015, Atomic Diffusion in Stars

    2015

  120. [129]

    2008, ApJ, 675, 1223

    Michaud, G., Richer, J., & Richard, O. 2008, ApJ, 675, 1223

    2008

  121. [130]

    2011, A&A, 529, A60

    Michaud, G., Richer, J., & Richard, O. 2011, A&A, 529, A60

    2011

  122. [131]

    & Siegel, W

    Migdalek, J. & Siegel, W. 2014, Journal of Physics B Atomic Molecular Physics, 47, 075003 Miller Bertolami, M. M., Althaus, L. G., Unglaub, K., & Weiss, A. 2008, A&A, 491, 253 Miller Bertolami, M. M., Battich, T., Córsico, A. H., Althaus, L. G., & Wachlin, F. C. 2022, MNRAS, 511, L60

    2014

  123. [132]

    Morton, D. C. 2000, ApJS, 130, 403

    2000

  124. [133]

    B., Yoca, S

    Motoumba, E. B., Yoca, S. E., Quinet, P., & Palmeri, P. 2020, Atomic Data and Nuclear Data Tables, 133, 101340

    2020

  125. [134]

    S., Behara, N

    Naslim, N., Jeffery, C. S., Behara, N. T., & Hibbert, A. 2011, MNRAS, 412, 363

    2011

  126. [135]

    S., Hibbert, A., & Behara, N

    Naslim, N., Jeffery, C. S., Hibbert, A., & Behara, N. T. 2013, MNRAS, 434, 1920

    2013

  127. [136]

    S., & Woolf, V

    Naslim, N., Jeffery, C. S., & Woolf, V . M. 2020, MNRAS, 491, 874 Németh, P. 2017, Open Astronomy, 26, 280 Németh, P., V os, J., Molina, F., & Bastian, A. 2021, A&A, 653, A3

    2020

  128. [137]

    E., Wahlgren, G

    Nielsen, K. E., Wahlgren, G. M., Proffitt, C. R., Leckrone, D. S., & Adelman, S. J. 2005, AJ, 130, 2312 Østensen, R. H., Jeffery, C. S., Saio, H., et al. 2020, MNRAS, 499, 3738 O’Sullivan, G. 1989, Journal of Physics B Atomic Molecular Physics, 22, 987 O’Toole, S. J. & Heber, ...

    2005

  129. [138]

    & Pettersson, S.-G

    Persson, W. & Pettersson, S.-G. 1984, Phys. Scr, 29, 308

    1984

  130. [139]

    & Wahlström, C.-G

    Persson, W. & Wahlström, C.-G. 1985, Phys. Scr, 31, 487

    1985

  131. [140]

    H., Ansbacher, W., Kernahan, J

    Pinnington, E. H., Ansbacher, W., Kernahan, J. A., Gosselin, R. N., & Bahr, J. L. 1985, Journal of the Optical Society of America B Optical Physics, 2, 1653

    1985

  132. [141]

    H., Bahr, J

    Pinnington, E. H., Bahr, J. L., Kernahan, J. A., & Irwin, D. J. G. 1981, Journal of Physics B Atomic Molecular Physics, 14, 1291

    1981

  133. [142]

    & Biémont, E

    Quinet, P. & Biémont, E. 2004, Atomic Data and Nuclear Data Tables, 87, 207

    2004

  134. [143]

    & Palmeri, P

    Quinet, P. & Palmeri, P. 2020, Atoms, 8, 18

    2020

  135. [144]

    1999, MNRAS, 307, 934

    Quinet, P., Palmeri, P., Biémont, E., et al. 1999, MNRAS, 307, 934

    1999

  136. [145]

    2002, Journal of Alloys and Com- pounds, 344, 255, proceedings of the Rare Earths‘ 2001 Conference

    Quinet, P., Palmeri, P., Biémont, E., et al. 2002, Journal of Alloys and Com- pounds, 344, 255, proceedings of the Rare Earths‘ 2001 Conference

    2002

  137. [146]

    Raassen, A. J. J. & Joshi, Y . N. 1991, Journal of Physics B Atomic Molecular Physics, 24, 921

    1991

  138. [147]

    Raassen, A. J. J., Uylings, P. H. M., Joshi, Y . N., & Wyart, J.-F. 1994, Phys. Scr, 49, 682 Radži¯ut˙e, L. & Gaigalas, G. 2022, Atomic Data and Nuclear Data Tables, 147, 101515

    1994

  139. [148]

    G., Bredice, F., et al

    Raineri, M., Reyna Almandos, J. G., Bredice, F., et al. 1998, J. Quant. Spectr. Rad. Transf., 60, 25

    1998

  140. [149]

    Rana, T., Tauheed, A., Tauheed, A., & Joshi, Y . N. 2001, Phys. Scr, 63, 108

    2001

  141. [150]

    K., Bagnulo, S., Ziegerer, E., Geier, S., & Fontaine, G

    Randall, S. K., Bagnulo, S., Ziegerer, E., Geier, S., & Fontaine, G. 2015, A&A, 576, A65

    2015

  142. [151]

    R., Badami, J

    Rao, K. R., Badami, J. S., & Fowler, A. 1931, Proceedings of the Royal Society of London. Series A, 131, 154

    1931

  143. [152]

    & Tauheed, A

    Rashid, A. & Tauheed, A. 2021, J. Quant. Spectr. Rad. Transf., 270, 107668

    2021

  144. [153]

    2020, A&A, 637, A4

    Rauch, T., Gamrath, S., Quinet, P., et al. 2020, A&A, 637, A4

    2020

  145. [154]

    2015, Tuebingen Oscillator Strengths Ser- vice Form Interface, VO resource provided by the GA VO Data Center

    Rauch, T., Quinet, P., Hoyer, D., et al. 2015, Tuebingen Oscillator Strengths Ser- vice Form Interface, VO resource provided by the GA VO Data Center

    2015

  146. [155]

    Rauch, T., Werner, K., Biémont, É., Quinet, P., & Kruk, J. W. 2012, A&A, 546, A55

    2012

  147. [156]

    Rauch, T., Werner, K., Quinet, P., & Kruk, J. W. 2014, A&A, 566, A10

    2014

  148. [157]

    Rauch, T., Werner, K., Quinet, P., & Kruk, J. W. 2015, A&A, 577, A6

    2015

  149. [158]

    1983, Journal of the Optical Society of America (1917-1983), 73, 349

    Reader, J. 1983, Journal of the Optical Society of America (1917-1983), 73, 349

    1983

  150. [159]

    & Acquista, N

    Reader, J. & Acquista, N. 1997, Phys. Scr, 55, 310

    1997

  151. [160]

    & Epstein, G

    Reader, J. & Epstein, G. L. 1972, Journal of the Optical Society of America (1917-1983), 62, 1467

    1972

  152. [161]

    & Wyart, J.-F

    Reader, J. & Wyart, J.-F. 2009, Phys. Rev. A, 80, 042517

    2009

  153. [162]

    U., Cowan, J

    Roederer, I. U., Cowan, J. J., Karakas, A. I., et al. 2010, ApJ, 724, 975

    2010

  154. [163]

    N., & Majumder, S

    Roy, S., Dutta, N. N., & Majumder, S. 2014, Phys. Rev. A, 89, 042511

    2014

  155. [164]

    N., Litzén, U., & Isberg, B

    Ryabtsev, A. N., Litzén, U., & Isberg, B. 1993, Phys. Scr, 48, 326

    1993

  156. [165]

    N., Raassen, A

    Ryabtsev, A. N., Raassen, A. J. J., Tchang-Brillet, W. Ü., et al. 1998, Phys. Scr, 57, 82 Sahal-Bréchot, S., M.S. Dimitrijevi ´c, & N. Moreau. 2025, STARK-B database, [online]. Available:http://stark-b.obspm.fr[2025, May 6]. Observa- tory of Paris, LERMA and Astronomical Obser...

    1998

  157. [166]

    & Jeffery, C

    Saio, H. & Jeffery, C. S. 2000, MNRAS, 313, 671

    2000

  158. [167]

    & Jeffery, C

    Saio, H. & Jeffery, C. S. 2019, MNRAS, 482, 758

    2019

  159. [168]

    L., Schneider, D., et al

    Schaffenroth, V ., Casewell, S. L., Schneider, D., et al. 2021, MNRAS, 501, 3847

    2021

  160. [169]

    Scott, L. J. A., Jeffery, C. S., Byrne, C. M., & Dorsch, M. 2024, MNRAS, 530, 2039

    2024

  161. [170]

    K., Rahimullah, K., & Tauheed, A

    Sharma, M. K., Rahimullah, K., & Tauheed, A. 2014, J. Quant. Spectr. Rad. Transf., 147, 102

    2014

  162. [171]

    2007, ApJ, 659, 1265

    Sharpee, B., Zhang, Y ., Williams, R., et al. 2007, ApJ, 659, 1265

    2007

  163. [172]

    2020, A&A, 635, L6

    Shetye, S., Van Eck, S., Goriely, S., et al. 2020, A&A, 635, L6

    2020

  164. [173]

    & Sugar, J

    Spector, N. & Sugar, J. 1976, Journal of the Optical Society of America (1917- 1983), 66, 436

    1976

  165. [174]

    Stark, M. A. & Wade, R. A. 2003, AJ, 126, 1455

    2003

  166. [175]

    2007, A&A, 462, 269

    Stroeer, A., Heber, U., Lisker, T., et al. 2007, A&A, 462, 269

    2007

  167. [176]

    & Kaufman, V

    Sugar, J. & Kaufman, V . 1972, Journal of the Optical Society of America (1917- 1983), 62, 562

    1972

  168. [177]

    & Kaufman, V

    Sugar, J. & Kaufman, V . 1974, Journal of the Optical Society of America (1917- 1983), 64, 1656

    1974

  169. [178]

    & Kaufman, V

    Sugar, J. & Kaufman, V . 1975, Phys. Rev. C, 12, 1336

    1975

  170. [179]

    S., Wan, Y ., Flowers, A., et al

    Taghadomi, Z. S., Wan, Y ., Flowers, A., et al. 2022, Atoms, 10, 94

    2022

  171. [180]

    Tauheed, A. & Hala. 2012, Phys. Scr, 85, 025304

    2012

  172. [181]

    N., & Kaufman, V

    Tauheed, A., Joshi, Y . N., & Kaufman, V . 1991, Journal of Physics B Atomic Molecular Physics, 24, 3701

    1991

  173. [182]

    N., & Pinnington, E

    Tauheed, A., Joshi, Y . N., & Pinnington, E. H. 1992, Journal of Physics B Atomic Molecular Physics, 25, L561

    1992

  174. [183]

    N., & Pinnington, E

    Tauheed, A., Joshi, Y . N., & Pinnington, E. H. 1998, Journal of Physics B Atomic Molecular Physics, 31, 393

    1998

  175. [184]

    N., & Zafaran, A

    Tauheed, A., Joshi, Y . N., & Zafaran, A. F. 2000, Phys. Scr, 62, 316

    2000

  176. [185]

    & Rashid, A

    Tauheed, A. & Rashid, A. 2021, J. Quant. Spectr. Rad. Transf., 261, 107435

    2021

  177. [186]

    & Reader, J

    Tauheed, A. & Reader, J. 2005, Phys. Scr, 72, 158

    2005

  178. [187]

    2008, A&A, 486, 923

    Unglaub, K. 2008, A&A, 486, 923

    2008

  179. [188]

    2010, in American Institute of Physics Conference Series, V ol

    Unglaub, K. 2010, in American Institute of Physics Conference Series, V ol. 1273, 17th European White Dwarf Workshop, ed. K. Werner & T. Rauch, 251–254

    2010

  180. [189]

    & Bues, I

    Unglaub, K. & Bues, I. 2001, A&A, 374, 570 van der Valk, A. A., Raassen, A. J. J., & Joshi, Y . N. 1990, Journal of the Optical Society of America B Optical Physics, 7, 1182 van Hoof, P. A. M. 2018, Galaxies, 6, 63 van Kleef, T. A. M. & Joshi, Y . N. 1982, Physica B+C, 114, 117

    2001

  181. [190]

    & Tauheed, A

    Varshney, S. & Tauheed, A. 2013, J. Quant. Spectr. Rad. Transf., 129, 31

    2013

  182. [191]

    & Tauheed, A

    Varshney, S. & Tauheed, A. 2016, J. Quant. Spectr. Rad. Transf., 168, 102

    2016

  183. [192]

    & Tauheed, A

    Varshney, S. & Tauheed, A. 2017, Atoms, 5, 23

    2017

  184. [193]

    M., Brage, T., Brandt, J

    Wahlgren, G. M., Brage, T., Brandt, J. C., et al. 2001, ApJ, 551, 520

    2001

  185. [194]

    Wajid, A., Tauheed, A., & Jabeen, S. 2021, J. Quant. Spectr. Rad. Transf., 258, 107387

    2021

  186. [195]

    Werner, K., Rauch, T., Knörzer, M., & Kruk, J. W. 2018, A&A, 614, A96

    2018

  187. [196]

    Werner, K., Rauch, T., Kuˇcas, S., & Kruk, J. W. 2015, A&A, 574, A29

    2015

  188. [197]

    Werner, K., Rauch, T., Ringat, E., & Kruk, J. W. 2012, ApJ, 753, L7

    2012

  189. [198]

    2025, Nature Reviews Physics, 7, 696

    Wiedeking, M., Goriely, S., Guttormsen, M., et al. 2025, Nature Reviews Physics, 7, 696

    2025

  190. [199]

    Wigner, E. P. 1931, Gruppentheorie und ihre Anwendung auf die Quanten- mechanik der Atomspektren, Die Wissenschaft: Einzeldarstellungen aus der Naturwissenschaft und der Technik (Braunschweig: F. Vieweg & Sohn)

    1931

  191. [200]

    1967, PhD thesis, University of British Columbia

    Wu, C.-M. 1967, PhD thesis, University of British Columbia

    1967

  192. [201]

    L., et al

    Wyart, J.-F., Meftah, A., Tchang-Brillet, W.-Ü. L., et al. 2007, Journal of Physics B Atomic Molecular Physics, 40, 3957

    2007

  193. [202]

    Wyart, J.-F., Raassen, A. J. J., Joshi, Y . N., & Uylings, P. H. M. 1992, Journal de Physique II, 2, 895

    1992

  194. [203]

    F., Raassen, A

    Wyart, J. F., Raassen, A. J. J., van het Hof, G. J., & Joshi, Y . N. 1993, Phys. Scr, 47, 784

    1993

  195. [204]

    L., Spector, N., et al

    Wyart, J.-F., Tchang-Brillet, W.-Ü. L., Spector, N., et al. 2001, Phys. Scr, 63, 113

    2001

  196. [205]

    2021, MNRAS, 504, 2670

    Yu, J., Zhang, X., & Lü, G. 2021, MNRAS, 504, 2670

    2021

  197. [206]

    2023, ApJS, 267, 12

    Zainab, A., Haris, K., Gamrath, S., Quinet, P., & Tauheed, A. 2023, ApJS, 267, 12

    2023

  198. [207]

    & Tauheed, A

    Zainab, A. & Tauheed, A. 2019, J. Quant. Spectr. Rad. Transf., 237, 106614

    2019

  199. [208]

    2014, European Physical Journal D, 68, 104

    Zhang, W., Palmeri, P., & Quinet, P. 2014, European Physical Journal D, 68, 104

    2014

  200. [209]

    s”) or broad (“b

    Zhang, X. & Jeffery, C. S. 2012, MNRAS, 419, 452 Article number, page 24 of 30 M. Dorsch et al.: Evidence for neutron capture in heavy-metal hot subdwarfs Appendix A: Additional material Appendix A.1: Atomic structure models Table A.1: Atomic structure models for Asiii, Seiii,...

    2012

Pith tools

Reviewed May 22, 2026 · model on record in the stance chip above.