Pith. sign in

REVIEW

A new symmetry-based framework for discovering minimum energy pathways

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1804.06798 v1 pith:43UHHT67 submitted 2018-04-18 cond-mat.mtrl-sci

classification cond-mat.mtrl-sci
keywords energypathwayssymmetryfinalframeworkinitialmethodsminimum
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Physical systems evolve from one state to another along paths of least energy barrier. Without a priori knowledge of the energy landscape, multidimensional search methods aim to find such minimum energy pathways between the initial and final states of a kinetic process. However in many cases, the user has to repeatedly provide initial guess paths, thus ensuring that the reliability of the final result is heavily user-dependent. Recently, the idea of "distortion symmetry groups" as a complete description of the symmetry of a path has been introduced. Through this, a new framework is enabled that provides a powerful means of classifying the infinite collection of possible pathways into a finite number of symmetry equivalent subsets, and then exploring each of these subsets systematically using rigorous group theoretical methods. The method is shown to lead to the discovery of new, previously hidden pathways for the case studies of bulk ferroelectric switching and domain wall motion in proper and improper ferroelectrics, as well as in multiferroic switching. This approach is applicable to a wide variety of physical phenomena ranging from structural, electronic and magnetic distortions, diffusion, and phase transitions in materials.

Discussion (0). Continue with ORCID to comment.

Pith tools