Pith. sign in

REVIEW 3 major objections 4 minor 1 cited by

Photometric and Spectroscopic Studies of Type Ic Supernovae SN 2020akf and SN 2021mxx

T0 review · 3 major / 4 minor · reviewed 2026-07-15 · grok-4.5

Pith's one-line read Two Type Ic supernovae yield ejecta masses and energies that place one as transitional and the other as unusually low-ratio normal.

desk verdict Solid observational addition of two Type Ic events with standard Arnett parameters; abstract-only so the numbers cannot be checked, but the work is the usual useful sample-building paper. read the letter →

arxiv 2607.12525 v1 pith:4SH6ZBFB submitted 2026-07-14 astro-ph.HE astro-ph.SR

classification astro-ph.HEastro-ph.SR
keywords TypeIcsupernovaeSN2020akf2021mxxArnettmodelejectedmasskineticenergynickelstripped-envelope
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper reports multi-epoch optical photometry and spectroscopy of two Type Ic supernovae, SN 2020akf and SN 2021mxx, spanning roughly five days before to more than 100 days after B-band maximum. From the light curves and spectra the authors construct quasi-bolometric luminosities, measure Fe II ejecta velocities, and fit a semi-analytical Arnett model to recover kinetic energy, ejected mass and nickel-56 mass for each event. SN 2020akf emerges with higher energy and mass and with spectral features intermediate between ordinary and broad-line Type Ic events, while SN 2021mxx is a normal Type Ic with an extremely low ejected-mass-to-kinetic-energy ratio. Host metallicities near both sites are sub-solar. The results enlarge the observed parameter space of stripped-envelope core-collapse explosions and supply concrete numbers that can be compared with other members of the class.

What carries the argument

The semi-analytical Arnett model, which assumes constant opacity, spherical homologous expansion, centrally concentrated 56Ni and pure radioactive powering, is fitted to the quasi-bolometric light curves to convert observed luminosity and velocity into estimates of ejected mass, kinetic energy and nickel mass.

What would settle it

Independent hydrodynamic modelling or late-time nebular spectroscopy that yields ejected masses or kinetic energies inconsistent with the Arnett-derived values for either supernova would falsify the reported parameters.

Watch

Extended reading notes

Core claim

SN 2020akf is a transitional Type Ic supernova whose spectral properties sit between normal and broad-line Type Ic events, while SN 2021mxx is a normal Type Ic supernova distinguished by an extremely low M_ej/E_k ratio; the Arnett-model parameters are E_k ≈ 6.33 × 10^51 erg, M_ej ≈ 4.71 M_☉, M_Ni ≈ 0.10 M_☉ for 2020akf and E_k ≈ 0.54 × 10^51 erg, M_ej ≈ 0.90 M_☉, M_Ni ≈ 0.05 M_☉ for 2021mxx.

Load-bearing premise

The Arnett model with its simplifying assumptions of constant opacity, spherical symmetry and centrally concentrated radioactive nickel correctly recovers the true ejected mass and kinetic energy from the light curves.

Editorial extensions

If this is right

  • SN 2020akf enlarges the sample of transitional Type Ic events that bridge normal and broad-line spectral classes.
  • SN 2021mxx demonstrates that normal Type Ic explosions can reach unusually low M_ej/E_k ratios, expanding the observed range of explosion parameters.
  • The derived nickel masses (0.10 and 0.05 solar masses) provide benchmarks for nucleosynthesis yields in stripped-envelope core-collapse models.
  • Host metallicities near 0.8 solar supply environmental context for progenitor channels of both objects.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The low M_ej/E_k of SN 2021mxx may point to a low-mass progenitor or highly asymmetric mass ejection that the spherical Arnett model underestimates.
  • If transitional objects like SN 2020akf are common, the boundary between normal and broad-line Type Ic supernovae may be continuous rather than discrete.
  • Future multi-wavelength coverage of similar events could test whether the optical quasi-bolometric luminosity undercounts the true energy budget.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 4 minor

Summary. The manuscript presents optical photometry and medium-resolution spectroscopy of two Type Ic supernovae, SN 2020akf (−5 to +109 d) and SN 2021mxx (−3 to +115 d) relative to B-band maximum. Peak quasi-bolometric luminosities are reported as log L_bol = 42.37 ± 0.02 and 42.21 ± 0.02 erg s−1. Fe II λ5169 velocities near maximum are ~15 000 km s−1 and ~10 000 km s−1. Applying the semi-analytical Arnett model, the authors derive E_k ≈ 6.33 × 10^51 erg, M_ej ≈ 4.71 M_⊙, M_Ni ≈ 0.10 M_⊙ for SN 2020akf and E_k ≈ 0.54 × 10^51 erg, M_ej ≈ 0.90 M_⊙, M_Ni ≈ 0.05 M_⊙ for SN 2021mxx. Host metallicities near the SN sites are ~0.81 and ~0.76 Z_⊙. They classify SN 2020akf as a transitional Ic (between normal and broad-line) and SN 2021mxx as a normal Ic with an extremely low M_ej/E_k ratio.

Significance. Well-sampled light curves and spectra of stripped-envelope SNe remain valuable for expanding the Type Ic parameter space. If the Arnett-derived parameters and the transitional classification hold under full scrutiny, SN 2020akf would help populate the intermediate region between normal and broad-line Ic events, while an extremely low M_ej/E_k for SN 2021mxx would be a useful constraint for explosion and progenitor models. Host-metallicity estimates near the explosion sites are a standard but useful addition for progenitor-environment studies. The work is incremental rather than transformative, but of clear interest to the SN community if the reductions, fits, and classifications are robust.

major comments (3)
  1. The central quantitative results (E_k, M_ej, M_Ni for both events) rest on the semi-analytical Arnett model applied to quasi-bolometric light curves. The abstract quotes only peak log L_bol and Fe II velocities; it does not report rise time, diffusion timescale τ_m, adopted opacity, nickel distribution, or the fitting procedure that converts those observables into the stated masses and energies. Without those intermediate quantities and the light curves themselves, the reported values—especially the “extremely low” M_ej/E_k for SN 2021mxx—cannot be independently checked for sensitivity to the usual Arnett assumptions (constant opacity, spherical homologous expansion, centrally concentrated 56Ni, pure radioactive powering). This is load-bearing for the paper’s main physical claims.
  2. Classification of SN 2020akf as transitional between normal and broad-line Type Ic, and of SN 2021mxx as normal Ic, is asserted from spectral properties. Only Fe II λ5169 velocities at maximum (~15 000 and ~10 000 km s−1) are given. Line-width measurements at multiple epochs, comparison spectra, and the quantitative criteria used to place 2020akf in the transitional category are not available in the abstract and must be shown and justified in the full analysis; otherwise the classification claim is not verifiable.
  3. The statement that SN 2021mxx has an “extremely low” M_ej/E_k ratio is a headline result. With M_ej ≈ 0.90 M_⊙ and E_k ≈ 0.54 × 10^51 erg the ratio is low relative to many published Ic samples, but its robustness depends on the same Arnett inputs and on how the quasi-bolometric light curve was constructed (filter coverage, bolometric corrections, distance/reddening). The manuscript must demonstrate that the low ratio survives reasonable variations in opacity, rise-time, and bolometric correction, and should place the ratio in a clearly defined comparison sample with consistent methodology.
minor comments (4)
  1. Abstract: units and spacing are inconsistent in places (e.g., “0.90 (+0.14)(-0.18),M_sun” with a stray comma; “SN~2020akf” TeX-style tildes). Clean for journal style.
  2. Abstract: “the velocities of the ejecta, derived from the Fe II 5169 A line” — specify whether this is the absorption minimum at maximum light only or a time series, and whether other lines (e.g., O I, Ca II) were checked for consistency.
  3. Host metallicities are given as ~0.81 and ~0.76 Z_⊙ “near the SN regions.” The full text should state the diagnostic (e.g., which strong-line method), aperture, and uncertainty, and whether the values are local or galaxy-averaged.
  4. Error bars on E_k and M_ej are asymmetric and relatively tight. The full analysis should clarify whether these are statistical only or include systematic contributions from opacity, distance, and reddening.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: Arnett-model parameters are standard external fits to new light-curve data, not self-referential by construction.

full rationale

Only the abstract is available. It reports new photometry and spectroscopy for SN 2020akf and SN 2021mxx, then applies the well-known external semi-analytical Arnett model to the quasi-bolometric light curves to obtain E_k, M_ej and M_Ni. The model is not defined in terms of the target results; the data are new; and no uniqueness theorem, self-citation chain, or ansatz smuggled from the authors’ prior work is invoked. Fitting an established external model to new observations is ordinary scientific practice and does not constitute circularity under the stated criteria (self-definitional, fitted-input-called-prediction that is forced by construction, load-bearing self-citation, etc.). Residual model dependence (constant opacity, nickel distribution) is a domain assumption, not a self-referential loop. With no full text, no equations, and no self-citations visible, no circular step can be exhibited by quotation. Score 0 is therefore the correct, proportionate finding.

Assumptions & free parameters 2 free parameters · 3 assumptions · 0 invented entities

The central claims rest on standard observational reductions plus the semi-analytic Arnett framework and the usual spectroscopic velocity tracer. No new physical entities are introduced; free parameters are those conventionally adjusted when fitting Arnett models to light curves. Full numerical values of opacity, nickel mixing, and distance/extinction priors are not stated in the abstract.

free parameters (2)
  • Arnett-model M_Ni, M_ej, E_k (both SNe) = 2020akf: M_Ni=0.10±0.02 M_sun, M_ej=4.71 M_sun, E_k=6.33e51 erg; 2021mxx: M_Ni=0.05±0.01 M_sun, M_ej=0.90 M_sun, E_k=0.5
    These three quantities per supernova are adjusted to match the quasi-bolometric light curves; the abstract reports the best-fit values and asymmetric uncertainties.
  • Host metallicity scale near SN sites = ~0.81 Z_sun (2020akf), ~0.76 Z_sun (2021mxx)
    Reported as ~0.81 Z_sun and ~0.76 Z_sun; the abstract does not specify the strong-line calibration or aperture, so the zero-point is an external free choice.
assumptions (3)
  • domain assumption Semi-analytical Arnett model (constant opacity, homologous expansion, centrally concentrated 56Ni, radioactive powering only) applies to these Type Ic light curves.
    Invoked explicitly for the E_k and M_ej estimates; known to be approximate for aspherical or mixed ejecta.
  • domain assumption Fe II 5169 Å absorption minimum traces the photospheric velocity at maximum light.
    Used to quote ~15 000 km/s and ~10 000 km/s; standard but line-blending and optical-depth effects can bias the measurement.
  • domain assumption Quasi-bolometric luminosity can be constructed from the available optical bands with the stated uncertainties.
    Underpins the peak log L_bol values; missing UV/IR corrections are a common systematic.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Photometric and Spectroscopic Studies of Type Ic Supernovae SN 2020akf and SN 2021mxx." pith.science (2026). https://pith.science/paper/4SH6ZBFB

@misc{pith2026260712525,
  author       = {Pith},
  title        = {Pith review of: Photometric and Spectroscopic Studies of Type Ic Supernovae SN 2020akf and SN 2021mxx},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/4SH6ZBFB}},
  note         = {Machine review of arXiv:2607.12525}
}
read the original abstract

We present a comprehensive analysis of optical photometry and medium-resolution spectroscopy for Type Ic supernovae (SNe) SN 2020akf and SN 2021mxx. Our study covers the evolution of SN 2020akf from -5 to 109 days and SN 2021mxx from -3 to 115 days relative to their B-band maximum. Their peak quasi-bolometric luminosities are estimated at logL_bol = 42.37 +- 0.02 and 42.21 +- 0.02 erg/s, respectively. The velocities of the ejecta, derived from the Fe II 5169 A line at maximum light, are approximately 15000 km/s for SN~2020akf and about 10000 km/s for SN~2021mxx, which are consistent with those observed in other Type~Ic SNe. Using the semianalytical Arnett model, we estimate that SN 2020akf has a kinetic energy of E_k = 6.33 (+0.68)(-0.62) x 10^51 erg and an ejected mass of M_ej = 4.71 (+0.50)(-0.46) M_sun, while for SN 2021mxx, we get E_k = 0.54 (+0.08)(-0.12) x 10^51 erg and M_ej = 0.90 (+0.14)(-0.18),M_sun. The mass of Ni56 synthesized in the explosion is estimated at 0.10 +- 0.02 M_sun for SN 2020akf and 0.05 +- 0.01 M_sun for SN 2021mxx. The metallicities of the host galaxies near the SN regions are ~0.81 Z_sun for SN 2020akf and ~0.76 Z_sun for SN 2021mxx, where Z_sun indicates solar metallicity. Our detailed analysis suggests that SN 2020akf falls into the category of a transitional Type Ic SN, having spectral properties between normal and broad-line Type Ic SNe, while SN 2021mxx is a normal Type Ic SN with an extremely low value of the M_ej / E_k ratio.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Dust Without Na I D Trace: The Case of Highly Attenuated Type Ib SN 2024vjc

    astro-ph.HE 2026-07 conditional novelty 6.0 of 10

    SN 2024vjc is substantially dust-attenuated (E(B-V)~0.45–0.8 mag) despite weak Na I D absorption that would imply only ~0.18 mag, a clear counterexample to that common diagnostic.

Pith tools

Reviewed July 15, 2026 · model on record in the stance chip above.