Pith. sign in

REVIEW 1 cited by

Robust Sequential DeepFake Detection

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2309.14991 v2 pith:BX2BCSPG submitted 2023-09-26 cs.CV

classification cs.CV
keywords seq-deepfakedeepfakefacialmanipulationsequentialdetectingdatasetdetection
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

Since photorealistic faces can be readily generated by facial manipulation technologies nowadays, potential malicious abuse of these technologies has drawn great concerns. Numerous deepfake detection methods are thus proposed. However, existing methods only focus on detecting one-step facial manipulation. As the emergence of easy-accessible facial editing applications, people can easily manipulate facial components using multi-step operations in a sequential manner. This new threat requires us to detect a sequence of facial manipulations, which is vital for both detecting deepfake media and recovering original faces afterwards. Motivated by this observation, we emphasize the need and propose a novel research problem called Detecting Sequential DeepFake Manipulation (Seq-DeepFake). Unlike the existing deepfake detection task only demanding a binary label prediction, detecting Seq-DeepFake manipulation requires correctly predicting a sequential vector of facial manipulation operations. To support a large-scale investigation, we construct the first Seq-DeepFake dataset, where face images are manipulated sequentially with corresponding annotations of sequential facial manipulation vectors. Based on this new dataset, we cast detecting Seq-DeepFake manipulation as a specific image-to-sequence task and propose a concise yet effective Seq-DeepFake Transformer (SeqFakeFormer). To better reflect real-world deepfake data distributions, we further apply various perturbations on the original Seq-DeepFake dataset and construct the more challenging Sequential DeepFake dataset with perturbations (Seq-DeepFake-P). To exploit deeper correlation between images and sequences when facing Seq-DeepFake-P, a dedicated Seq-DeepFake Transformer with Image-Sequence Reasoning (SeqFakeFormer++) is devised, which builds stronger correspondence between image-sequence pairs for more robust Seq-DeepFake detection.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Modelship Attribution: Tracing Multi-Stage Manipulations Across Generative Models

    cs.CV 2025-06 conditional novelty 6.0 of 10

    Modelship Attribution is defined as a new task with an 83,700-image dataset built from three face-swap models, and a transformer, MAT, that predicts the editing model sequence with 76.01% strict-match accuracy.

Pith tools