Pith. sign in

REVIEW 2 major objections 4 minor 10 references

Brightening of Long, Polymer-Wrapped Carbon Nanotubes by sp$^{3}$ Functionalization in Organic Solvents

T0 review · 2 major / 4 minor · reviewed 2026-08-14 · deepseek-v4-flash

Pith's one-line read This paper introduces a scalable phase-transfer method for attaching sp$^3$ aryl defects to polymer-wrapped carbon nanotubes in organic solvents, achieving photoluminescence quantum yields up to 4% with more than 90% of emission through…

desk verdict A genuinely useful phase-transfer method for sp3-functionalizing polymer-wrapped SWNTs in organic solvents, with careful PLQY work; the trap-depth trend rests on an assumption the authors flag but don't verify. read the letter →

arxiv 1908.02354 v1 pith:E6J2JVYJ submitted 2019-08-06 physics.app-ph cond-mat.mes-hall

classification physics.app-phcond-mat.mes-hall
keywords single-walledcarbonnanotubessp3defectsdiazoniumfunctionalizationphotoluminescencequantumyieldpolymerwrappingphase-transferreactionnear-infraredemissionnanotubefilms
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper establishes a scalable chemical route for attaching luminescent sp$^3$ defects to polymer-wrapped single-walled carbon nanotubes directly in organic solvents, something previously possible only for surfactant-coated tubes in water. The central claim is that dissolving aryldiazonium salts with a crown-ether phase-transfer agent in a toluene/acetonitrile mixture gives enough control over defect density to raise the absolute photoluminescence quantum yield of (6,5) nanotubes to up to 4%, with over 90% of emitted photons coming from the defect channel. The authors also show that deeper exciton traps and higher-quality starting tubes give the highest absolute yields, while shorter, more damaged tubes show the largest relative brightening. Because the functionalized tubes remain dispersible and printable, this points toward brighter near-infrared nanotube films for light-emitting devices.

What carries the argument

The mechanism that carries the argument is a phase-transfer reaction: the crown ether 18-crown-6 complexes aryldiazonium cations and brings them into an organic mixture of toluene and acetonitrile, where polymer-wrapped (6,5) nanotubes remain colloidally stable, allowing controlled room-temperature attachment of aryl sp$^3$ defects. Around each defect, the nanotube lattice gains a localized exciton trap whose optical depth, the $E_{11}$-to-$E_{11}^*$ energy gap of 167 to 184 meV for the substituents studied, determines how efficiently trapped excitons radiate before thermal detrapping or non-radiative decay. The paper's quantitative backbone is absolute PLQY measured in an integrating sphere under low pulsed excitation, which lets the authors separate defect-density effects from trap-depth effects and compare dispersion and film performance.

What would settle it

Measure the actual sp3 defect density in the four optimized samples, for example by the Raman D/G+ ratio or the integrated $E_{11}^*/E_{11}$ absorbance, and test whether it is equal across substituents; if the deeper-trap samples also have more defects, the reported PLQY-versus-trap-depth trend would not be established.

Watch

Extended reading notes

Core claim

On the paper's own terms, the discovery is that sp$^3$ aryl functionalization, the standard strategy for brightening carbon nanotubes through localized exciton traps, can be transferred from aqueous surfactant dispersions to high-purity, polymer-wrapped nanotubes in organic solvents without sacrificing processability. Using 18-crown-6 to solubilize preformed diazonium salts in an 80:20 toluene/acetonitrile mixture, the authors introduce 4-bromo, 4-nitro, 3,5-dichloro, and 4-methoxy aryl defects into PFO-BPy-wrapped (6,5) SWNTs at room temperature, then quantify the effect with absolute integrating-sphere photoluminescence quantum yield measurements. They find that total PLQY rises with defect density up to an optimum, reaching 3.8 to 4.3%, and that deeper traps, with optical trap depths from 167 to 184 meV, give higher total PLQY, longer defect-state lifetimes (205 to 257 ps), and a larger fraction of emission through the defect channel (up to about 90 to 92%). They further show that initial nanotube length and quality set the brightening factor: long shear-mixed tubes retain the highest absolute PLQY after functionalization, while short tip-sonicated tubes with low starting PLQY show the largest relative brightening, about 2.5-fold. Finally, the functionalized tubes can be aerosol-jet printed or spin-coated into films that keep a 1.7-fold PL intensity and PLQY enhancement over pristine tubes.

Load-bearing premise

The comparison that attributes higher quantum yields to deeper traps assumes that the four differently substituted defect samples contained the same number of defects, but that equality was not independently checked.

Editorial extensions

If this is right

  • Optimized sp$^3$ functionalization in organic solvents gives dispersions with absolute PLQYs near 4% and defect-channel emission above 90%, raising the brightness available to solution-processed nanotube emitters.
  • Because the reaction works at room temperature in nonhalogenated solvents and scales to several hundred milliliters, large batches of defect-tailored tubes can be made for printing and coating.
  • Deeper optical traps produce both higher PLQY and longer defect-state lifetimes, so further deepening or redesigning of traps is a concrete route to even brighter emission.
  • The brightening factor is largest for short, low-quality tubes, meaning defect functionalization can rescue otherwise dark nanotubes, while the highest absolute yields still come from long, high-quality tubes.
  • Films retain the functionalization benefit, with a 1.7-fold brighter PL and PLQY, and the defect emission's redshift makes it nearly reabsorption-free in thick films.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If the same phase-transfer scheme works with other wrapping polymers and nanotube chiralities, which the authors expect but do not test, it would become a general platform for defect-brightened nanotube inks.
  • The trap-depth comparison assumes matched defect densities across the four substituent samples without independent verification; repeating it with explicit density matching by Raman D/G+ ratio or $E_{11}^*/E_{11}$ absorbance would turn the trap-depth trend into a quantitative design rule.
  • The measured $E_{11}^*$ Stokes shift of about 20 meV is far below computed reorganization energies, suggesting optical trap depth may not equal the thermal detrapping barrier; temperature-dependent PLQY measurements could decide which loss channel actually limits brightness.
  • The strong excitation-power dependence of the $E_{11}^*/E_{11}$ PL ratio implies that literature values of this ratio are only comparable at fixed pump conditions, and absolute PLQY measurements should become the standard metric.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

2 major / 4 minor

Summary. The manuscript introduces a phase-transfer method for sp3 functionalization of polymer-wrapped (6,5) single-walled carbon nanotubes in organic solvents. Aryldiazonium salts are solubilized in a toluene/acetonitrile mixture with 18-crown-6 and a low concentration of potassium acetate, enabling controlled reaction with PFO-BPy-wrapped SWNTs at room temperature. The authors characterize the resulting defect emission, identify the E11* absorption band, determine absolute PLQYs in an integrating sphere at very low excitation fluence, and report total PLQYs up to about 4% with more than 90% of photons emitted through the defect channel. They investigate the influence of defect density, aryl substituent (trap depth), and initial SWNT length/quality on PLQY, and demonstrate that printed and spin-coated films of functionalized SWNTs are about 1.7 times brighter than pristine films.

Significance. If the results hold, the phase-transfer method provides a scalable route to bright, defect-engineered, polymer-sorted SWNT dispersions and films for near-infrared optoelectronics. The paper's strengths include absolute integrating-sphere PLQY measurements with a checked low-fluence regime, careful washing controls, and cross-validation of defect-density metrics via Raman D/G+ ratios and E11*/E11 absorbance. The claimed trap-depth dependence of PLQY and lifetime is plausible but rests on an explicit assumption of equal defect densities across substituent samples that is not verified for the actual samples used; this weakens the 'trap depth optimization' component of the headline claim. The length-dependence and film results are valuable and appear well supported.

major comments (2)
  1. [Photoluminescence Quantum Yields and Lifetimes (Fig. 4b/c, Table 1)] The conclusion that the maximum PLQY and the long lifetime component increase with optical trap depth rests on the explicit assumption that all four substituent samples have similar defect densities at their respective optimum reagent concentrations (main text, 'If we assume that we compensated the differences in reactivity...'). This assumption is not verified for the actual samples: the Raman D/G+ and E11*/E11 absorbance metrics that calibrate defect density are reported only for the 4-bromophenyl series (Fig. 3a, Supporting Information Figs. S5 and S6). For the 4-OMe, 3,5-Cl2, and 4-NO2 samples used in Fig. 4b/c, no direct defect-density measurement is presented. Because the PLQY is sharply peaked as a function of reagent concentration (Fig. 4a), and because the optimum concentrations span two orders of magnitude (0.037 to 3.7 mmol/L), even moderate density differences among the four samples could produce the observed trend in PLQY and tau_long without any intrinsic trap-depth effect. The authors should measure a defect-density metric (e.g., Raman D/G+ or E11*/E11 absorbance) on the exact samples used for Fig. 4b/c, or otherwise demonstrate that the four samples are at equivalent defect densities. Without this, the 'trap depth optimization' component of the headline claim is not established.
  2. [Photoluminescence Quantum Yields and Lifetimes (Fig. 4b)] The differences in total PLQY among substituents (3.0% to 3.8%) and in E11* PLQY (2.5% to 3.5%) are comparable to the stated absolute measurement error of about 10% of the value (Supporting Information, 'Photoluminescence Quantum Yield Measurements'), yet Fig. 4b shows no error bars or replicate measurements, and Fig. 4c shows no uncertainty in the fitted lifetimes. Given that these trends are the central evidence for the trap-depth dependence, the authors should report the propagation of the 10% error into the final values, show error bars or replicate points, and specify the fitting uncertainty for the lifetime components. As presented, the reader cannot assess whether the substituent trend is statistically robust or consistent with measurement noise.
minor comments (4)
  1. [Fig. 4b] The gray shaded areas are described as 'typical ranges of E11 and total PLQY of pristine (6,5) SWNTs', but it is unclear whether the E11 range refers to the E11 spectral contribution or the total PLQY; please clarify the labeling and specify the number of batches used to define these ranges.
  2. [Fig. 4b/c and Table 1] The optimum diazonium salt concentrations for each substituent are given in the text (0.037 mmol/L for 3,5-Cl2, 0.37 mmol/L for 4-Br, 3.7 mmol/L for 4-OMe, and 0.37 mmol/L for 4-NO2) but are not collected in a table; adding a table with the optimum concentrations, corresponding PLQYs, trap depths, and lifetime components would improve reproducibility.
  3. [Stokes Shift discussion] The term 'optical trap depth' is defined as the energy difference between the E11 and E11* PL emission maxima (Table 1), but the thermal detrapping arguments in the text implicitly equate this optical energy difference with the thermal activation energy; the authors should briefly note that the two quantities are not necessarily identical, especially given their own discussion of the complex relationship between trap depth and detrapping energy.
  4. [Film PLQY measurements] The thin-film PLQY values (0.18 ± 0.05% and 0.31 ± 0.06%) have large relative uncertainties, and the resulting brightening factor of 1.7 should be reported with a confidence interval or otherwise discussed in terms of the measurement error.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: the PLQY values, brightening factors, and defect-density metrics are independently measured, and the trap-depth comparison rests on an explicitly stated (if unverified) equal-defect-density assumption, which is a confound risk rather than a circular reduction.

full rationale

Walking the derivation chain, the central quantities are measured rather than defined in terms of the claims. Absolute PLQY is obtained by an integrating-sphere method ('the PLQY was determined directly by measuring the laser absorption at the E22 transition and PL emission of the sample in an integrating sphere'), and the brightening factor is the ratio of two measured PLQY values ('the relative brightening, which we define as the ratio of final PLQY/initial PLQY'). The defect-density metrics (Raman D/G+ ratio and E11*/E11 absorbance ratio) are independently measured and correlated with reagent concentration (Figure 3a), and the paper explicitly warns that the E11*/E11 PL ratio is power-dependent and should not be used as a defect-density metric without fixed excitation conditions. The trap-depth comparison in Figure 4b/c is the only step that relies on an assumption: 'If we assume that we compensated the differences in reactivity of the various diazonium salts by adjusting their concentrations, all samples compared in Figure 4b and 4c should have similar defect densities. With this assumption we can attribute the substituent dependence of PLQY to the changes in trap depth.' This is an acknowledged, testable assumption; it could confound the PLQY-versus-trap-depth trend with defect-density differences, but it is not a circular reduction because PLQY, lifetimes, and optical trap depths are separately measured quantities. Self-citations to Ref. 9 for the dispersion and absolute-PLQY method and to Refs. 26/27/29 for decay-dynamics interpretation are methodological and literature support, not the target result, and no load-bearing claim reduces to an unverified self-citation. No equation or definition makes the predicted quantity equivalent to its input by construction.

Assumptions & free parameters 2 free parameters · 4 assumptions · 0 invented entities

No theoretical free parameters are fitted; the reaction conditions listed are experimental variables. The central claims rest on standard domain assumptions in nanotube spectroscopy and one explicit equal-defect-density assumption for the substituent comparison. No invented entities are introduced.

free parameters (2)
  • 18-crown-6 concentration = 7.6 mmol L-1
    Chosen so that crown ether concentration equals or exceeds the diazonium salt concentration because crown ethers are stoichiometrically bound by unreacted diazonium cations; an experimental design choice, not fitted to optical data.
  • KOAc concentration = ~10^-9 mol L-1
    Selected from the selectivity comparison in Figure S2 to reduce deeper E11*- traps; an empirically optimized reaction condition, not a model parameter.
assumptions (4)
  • domain assumption The Raman D/G+ intensity ratio is proportional to the density of sp3 defects.
    Used throughout as the primary defect-density metric (Figure 3a and Figure S5); follows standard nanotube literature (ref 50) and is validated internally by roughly linear dependence on reagent concentration.
  • domain assumption The absorption band at about 1142 nm assigned to E11* arises from sp3 defects rather than residual diazonium species or by-products.
    Assignment rests on washing removing unreacted salt and on the absence of this band in the untreated reference; additional support comes from the growth of the band with reagent concentration.
  • ad hoc to paper All four substituent samples have similar defect densities at their respective optimum reagent concentrations.
    Explicit assumption in the main text before Figure 4b/c: 'If we assume that we compensated the differences in reactivity... all samples compared in Figure 4b and 4c should have similar defect densities.' This was not directly verified by Raman or absorption on those samples.
  • domain assumption Absolute PLQY measurements are in the linear excitation regime with negligible exciton-exciton annihilation and negligible reabsorption.
    Supported by a calculation of about 10^-3 excitons per nanotube and by near-identical E11*/E11 ratios under lamp and pulsed excitation; samples were diluted to an optical density of 0.2 at E11 to suppress self-absorption.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Brightening of Long, Polymer-Wrapped Carbon Nanotubes by sp$^{3}$ Functionalization in Organic Solvents." pith.science (2026). https://pith.science/paper/E6J2JVYJ

@misc{pith2026190802354,
  author       = {Pith},
  title        = {Pith review of: Brightening of Long, Polymer-Wrapped Carbon Nanotubes by sp$^3$ Functionalization in Organic Solvents},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/E6J2JVYJ}},
  note         = {Machine review of arXiv:1908.02354}
}
abstract

The functionalization of semiconducting single-walled carbon nanotubes (SWNTs) with sp$^{3}$ defects that act as luminescent exciton traps is a powerful means to enhance their photoluminescence quantum yield (PLQY) and to add optical properties. However, the synthetic methods employed to introduce these defects are so far limited to aqueous dispersions of surfactant-coated SWNTs, often with short tube lengths, residual metallic nanotubes and poor film formation properties. In contrast to that, dispersions of polymer-wrapped SWNTs in organic solvents feature unrivaled purity, higher PLQY and are easily processed into thin films for device applications. Here, we introduce a simple and scalable phase-transfer method to solubilize diazonium salts in organic nonhalogenated solvents for the controlled reaction with polymer-wrapped SWNTs to create luminescent aryl defects. Absolute PLQY measurements are applied to reliably quantify the defect-induced brightening. The optimization of defect density and trap depth results in PLQYs of up to 4 % with 90 % of photons emitted through the defect channel. We further reveal the strong impact of initial SWNT quality and length on the relative brightening by sp$^{3}$ defects. The efficient and simple production of large quantities of defect-tailored polymer-sorted SWNTs enables aerosol-jet printing and spin-coating of thin films with bright and nearly reabsorption-free defect emission, which are desired for carbon nanotube-based near-infrared light-emitting devices.

Figures

Figures reproduced from arXiv: 1908.02354 by the authors.

Figure 2
Figure 2. a) Normalized absorption spectra and b) PL spectra recorded under pulsed excitation (575 nm, ~0.5 mJ cm-2 ) of PFO-BPy-wrapped (6,5) SWNTs in toluene functionalized using different concentrations of 4-bromobenzenediazonium tetrafluoroborate in the reaction mixture to adjust the defect density. c) Stokes shift of E11 (black) and E11* (red) transition as a function of diazonium salt concentration. Solid lines are guid… view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

10 extracted references · 10 canonical work pages

  1. [1]

    E., The Synthesis of Biaryl Compounds by Means of the Diazo Reaction

    Gomberg, M.; Bachmann, W. E., The Synthesis of Biaryl Compounds by Means of the Diazo Reaction. J. Am. Chem. Soc. 1924, 46, 2339-2343

  2. [2]

    P.; Chenevier, P., Mechanism of the Coupling of Diazonium to Single-Walled Carbon Nanotubes and Its Consequences

    Schmidt, G.; Gallon, S.; Esnouf, S.; Bourgoin, J. P.; Chenevier, P., Mechanism of the Coupling of Diazonium to Single-Walled Carbon Nanotubes and Its Consequences. Chem. Eur. J. 2009, 15, 2101-2110

  3. [3]

    A.; Sharf, T.; Myles, D

    Wilson, H.; Ripp, S.; Prisbrey, L.; Brown, M. A.; Sharf, T.; Myles, D. J. T.; Blank, K. G.; Minot, E. D., Electrical Monitoring of sp 3 Defect Formation in Individual Carbon Nanotubes. J. Phys. Chem. C 2016, 120, 1971-1976

  4. [4]

    R.; Korzeniowski, S

    Beadle, J. R.; Korzeniowski, S. H.; Rosenberg, D. E.; Garcia -Slanga, B. J.; Gokel, G . W., Phase-Transfer-Catalyzed Gomberg-Bachmann Synthesis of Unsymmetrical Biarenes: A Survey of Catalysts and Substrates. J. Org. Chem. 1984, 49, 1594-1603

  5. [5]

    R.; Valley, N.; Kwon, H.; Schatz, G

    Piao, Y.; Meany, B.; Powell, L. R.; Valley, N.; Kwon, H.; Schatz, G. C.; Wang, Y., Brightening of Carbon Nanotube Photoluminescence through the Incorporation of sp3 Defects. Nat. Chem. 2013, 5, 840-845

  6. [6]

    K.; Bachilo, S

    Streit, J. K.; Bachilo, S. M.; Ghosh, S.; Lin, C. W.; Weisman, R. B., Directly Measured Optical Absorption Cross Sections for Structure -Selected Single-Walled Carbon Nanotubes. Nano Lett. 2014, 14, 1530-1536

  7. [7]

    S.; Jorio, A.; Souza Filho, A

    Dresselhaus, M. S.; Jorio, A.; Souza Filho, A. G.; Saito, R., Defect Characterization in Graphene and Carbon Nanotubes Using Raman Spectroscopy. Phil. Trans. R. Soc. A 2010, 368, 5355-5377

  8. [8]

    V.; Ghosh, S.; Tsyboulski, D

    Naumov, A. V.; Ghosh, S.; Tsyboulski, D. A.; Bachilo, S. M.; Weisman, R. B., Analyzing Absorption Backgrounds in Single -Walled Carbon Nanotube Spectra. ACS Nano 2011, 5, 1639-1648

Show all 10 references
  1. [9]

    D.; Graf, A.; Zaumseil, J.; Krupke, R.; Flavel, B

    Pfohl, M.; Tune, D. D.; Graf, A.; Zaumseil, J.; Krupke, R.; Flavel, B. S., Fitting Single- Walled Carbon Nanotube Optical Spectra. ACS Omega 2017, 2, 1163-1171

  2. [10]

    P.; Backes, C.; Pfohl, M.; Flavel, B

    Graf, A.; Zakharko, Y.; Schießl, S. P.; Backes, C.; Pfohl, M.; Flavel, B. S.; Zaumseil, J., Large Scale, Selective Dispersion of Long Single- Walled Carbon Nanot ubes with High Photoluminescence Quantum Yield by Shear Force Mixing. Carbon 2016, 105, 593-599

Pith tools

Reviewed August 14, 2026 · model on record in the stance chip above.