pith. sign in

arxiv: 1211.6676 · v2 · pith:J2AR7BJHnew · submitted 2012-11-28 · ❄️ cond-mat.mes-hall

Low-energy Electron Reflectivity from Graphene

classification ❄️ cond-mat.mes-hall
keywords graphenereflectivityminimaenergyexperimentallyfoundlow-energynumber
0
0 comments X
read the original abstract

Low-energy reflectivity of electrons from single- and multi-layer graphene is examined both theoretically and experimentally. A series of minima in the reflectivity over the energy range of 0 - 8 eV are found, with the number of minima depending on the number of graphene layers. Using first-principles computations, it is demonstrated that a free standing n-layer graphene slab produces n-1 reflectivity minima. This same result is also found experimentally for graphene supported on SiO2. For graphene bonded onto other substrates it is argued that a similar series of reflectivity minima is expected, although in certain cases an additional minimum occurs, at an energy that depends on the graphene-substrate separation and the effective potential in that space.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.