Pith. sign in

REVIEW 4 major objections 5 minor 42 references

Precision Measurement of the Optical Conductivity of Atomically Thin Crystals via Photonic Spin Hall Effect

T0 review · 4 major / 5 minor · reviewed 2026-08-14 · deepseek-v4-flash

Pith's one-line read Using the photonic spin Hall effect as a measurement pointer, this paper reports monolayer graphene conductivity $(0.993\pm0.005)\sigma_0$ and a linear layer-number scaling for untwisted few-layer graphene.

desk verdict The headline precision claim is not established, but the weak-value-amplified photonic SHE approach to graphene conductivity is a legitimate idea that deserves careful peer review. read the letter →

arxiv 1908.02043 v1 pith:LPW7TIL4 submitted 2019-08-06 physics.optics cond-mat.mes-hall

classification physics.opticscond-mat.mes-hall
keywords photonicspinHalleffectweak-valueamplificationopticalconductivitygraphenefew-layerprecisionmeasurementspin-orbitcouplingoflighttwo-dimensionalmaterials
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

Absorption-based measurements of optical conductivity in atomically thin crystals are limited by weak light-matter interaction. This paper makes the tiny spin-dependent transverse shift of a reflected beam, the photonic spin Hall effect, the measurable pointer, and uses weak-value amplification to magnify that shift by thousands of times. With this pointer, monolayer graphene is found to have conductivity $(0.993\pm0.005)\sigma_0$, matching the predicted universal constant $\sigma_0=e^2/4\hbar$, at a resolution of $1.5\times10^{-8}\,\Omega^{-1}$. For untwisted bilayer and trilayer graphene, the fitted conductivities are close to $2\sigma_0$ and $3\sigma_0$, so conductivity scales linearly with layer number. If correct, this is a non-contact, high-resolution route for characterizing two-dimensional crystals and for measuring magneto-optical, dichroic, and nonlinear response.

What carries the argument

The central object is the spin-dependent shift $\delta$ of the reflected beam, the photonic spin Hall shift, which acts as the measurement pointer. The paper uses weak-value amplification, a postselection technique that magnifies a small pointer shift by making the preselected and postselected states nearly orthogonal: the spin is preselected in horizontal polarization and postselected in a near-orthogonal state, producing the complex weak value $A_w=i\cot\beta$ in the experiment. The linear-theory amplified shift is $\langle y\rangle=(z/z_r)\cot\beta\,\delta$, and the full fitting expression used at small $\beta$ is given in the paper. The chain from sample to number runs through the surface-current boundary conditions that place $\sigma$ in $r_p$ and $r_s$, then through $\delta$, then through the weak-value amplification.

What would settle it

Repeat the measurement on the same films after independently determining the layer number by atomic-force step-height or layer-resolved vibrational spectroscopy; if a supposed monolayer is actually a bilayer or contains folded regions, the fitted conductivity will move away from the universal value and the linear layer scaling will fail.

Watch

Extended reading notes

Core claim

The paper establishes that the reflection of a light beam from a graphene-covered interface carries a measurable imprint of the film's optical conductivity. Treating graphene as a zero-thickness conducting film puts the conductivity $\sigma$ into the reflectance coefficients $r_p$ and $r_s$; the spin-orbit coupling of reflection converts those coefficients into a tiny transverse spin-dependent shift $\delta=(r_p+r_s)\cot\theta_i/(k_0 r_p)$. The shift is amplified by a weak-value measurement with a near-orthogonal postselection, giving a centroid displacement that is fitted as a function of the postselection angle. The fitted monolayer value is $(0.993\pm0.005)\sigma_0$; the bilayer and trilayer values are approximately $2\sigma_0$ and $3\sigma_0$ for untwisted samples. The electric-susceptibility contribution is estimated from earlier fits and is found to be negligible in the visible range.

Load-bearing premise

The results assume the three samples really are untwisted single, double, and triple layers of graphene; the paper does not show how the layer count was established, and it deliberately leaves twist out of the model.

Editorial extensions

If this is right

  • Monolayer graphene's optical conductivity is measured as $(0.993\pm0.005)\sigma_0$, consistent with the predicted universal value $\sigma_0=e^2/4\hbar$.
  • The measurement resolution for optical conductivity reaches $1.5\times10^{-8}\,\Omega^{-1}$, which the paper reports as its measuring resolution.
  • For untwisted few-layer graphene, the fitted conductivities of bilayer and trilayer samples are close to $2\sigma_0$ and $3\sigma_0$, so conductivity increases linearly with layer number.
  • The same weak-value amplified photonic spin Hall pointer can be applied to other atomically thin crystals to measure parameters such as magneto-optical constants, circular dichroism, and optical nonlinear coefficients, as the paper proposes.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Beyond the paper, the sub-$\sigma_0$ resolution suggests the same pointer could detect small conductivity changes from doping, strain, or substrate screening, since these shift the conductivity by fractions of the universal constant.
  • The paper fits only the real part of the conductivity in the visible range; an unstated extension is to use the complex weak value or a different wavelength to extract both real and imaginary parts of $\sigma$.
  • Because the conductivity enters through reflectance coefficients, the same arrangement could function as an in-situ, non-contact conductivity monitor during gating or chemical treatment of a two-dimensional sample.
  • The linear layer-number scaling is explicitly limited to untwisted films; measuring twisted bilayer or magic-angle samples would test how interlayer coupling modifies the simple $N\sigma_0$ rule, a direction the paper names as interesting.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 5 minor

Summary. The paper proposes and demonstrates a measurement of the optical conductivity of atomically thin crystals by using the photonic spin Hall effect as a pointer and weak-value amplification as a sensitivity enhancer. Graphene samples (monolayer, bilayer, trilayer on SiO2) are modeled as zero-thickness conducting sheets, and the amplified spin-dependent shift is measured as a function of the postselection angle β. The authors report a monolayer optical conductivity of (0.993±0.005)σ0, a measuring resolution of 1.5×10^-8 Ω^-1, and a linear increase of conductivity with layer number for few-layer graphene without twist. The central claims rest on fitting the measured shifts to the strict expression in Eq. (8), whose derivation is deferred to a Supplemental Material, and on a resolution estimate based on the linear formula in Eq. (7).

Significance. If the result is correct, the paper demonstrates a non-contact, all-optical metrology technique for the optical conductivity of two-dimensional crystals with sub-percent precision, without the need for contacting electrodes or absorption spectroscopy. The extension to chirality, magneto-optical response, and nonlinear coefficients would be of wide interest. The paper builds on a plausible zero-thickness boundary-condition model and uses established weak-measurement amplification in a clean experimental geometry. However, the quantitative precision claims are not currently supported by a checkable derivation or uncertainty budget, and the sample layer-count identification is not documented, so the central claims are conditional on those missing elements.

major comments (4)
  1. [Eq. (8) and fitting procedure] The central quantitative result is obtained by fitting the measured β-dependent amplified shifts to Eq. (8), but the derivation of Eq. (8) is deferred to the Supplemental Material and the fitting procedure is not described. The text does not state which parameters are held fixed (incidence angle, refractive indices, beam waist, Rayleigh length, propagation distance z, susceptibility χ), how the three independent data groups are combined or weighted, or how uncertainties in these parameters propagate into the extracted conductivity. The quoted ±0.005σ0 is not connected to any error budget. Without the derivation and the propagation analysis, the claimed half-percent precision cannot be independently assessed. I recommend presenting the derivation (or making the Supplemental Material available to referees) and adding a complete uncertainty analysis for the fitted σ.
  2. [Resolution claim based on Eq. (7)] The measuring resolution of 1.5×10^-8 Ω^-1 is computed from the linear weak-value expression Eq. (7) at β=2°, immediately after the authors state that Eq. (7) 'would fail to describe the weak-value amplification for small preselected angle β.' The strict expression Eq. (8) contains a denominator term [2k0zr(r_p'^2+r_p''^2)+ξ^2] sin^2β that removes the cotβ divergence, so the sensitivity d⟨y⟩/dσ at β=2° is not given by Eq. (7). The resolution number should be recalculated from Eq. (8), and the paper should explain why the quoted resolution (≈2.5×10^-4 σ0) is about 20 times smaller than the quoted fit accuracy (±0.005σ0).
  3. [Sample characterization] The claimed linear scaling of conductivity with layer number requires that the measured samples are untwisted monolayer, bilayer, and trilayer graphene. The main text only states that Raman spectra were used 'to confirm the region of graphene' (details in the Supplemental Material) and explicitly says that twist is not considered. No evidence is presented that establishes the layer count of each sample (e.g., AFM height, Raman 2D/G ratio, or substrate documentation), and no twist-angle characterization is provided. If a sample were misidentified or unintentionally twisted, the monolayer value and the N-layer scaling would be invalid. Please include the layer-count determination and a statement on twist, or withdraw/qualify the few-layer scaling claim.
  4. [Susceptibility χ uncertainty] The susceptibility χ is adopted as (8±3)×10^-10 m from Ref. [27], and the paper argues from Fig. 2(d) that its contribution to the amplified shift is negligible. However, no quantitative bound is given for the effect of the quoted ±3×10^-10 m uncertainty on the extracted optical conductivity. Since Eq. (8) depends on χ through the Fresnel coefficients, a 3×10^-10 m change in χ can shift the fitted σ by an amount that may be a substantial fraction of the claimed ±0.005σ0. Please quantify this systematic effect and include it in the uncertainty budget.
minor comments (5)
  1. [Title and text typos] The title contains 'Atomi cally' and the text contains 'dose not require' and 'the the beam waist'; these should be corrected.
  2. [Fig. 4] The caption and text should specify what the error bars represent (e.g., standard deviation over three incidence positions) and how the three data groups were defined; the fitting curves should be described in the caption.
  3. [Fig. 5] The numerical values of the bilayer and trilayer conductivities are not given; please report the extracted values with uncertainties in the text or figure caption.
  4. [Experimental parameters] For reproducibility, please list the substrate refractive index n2 and confirm the effective propagation distance z=250 mm and beam waist 21 μm in the experimental section; these parameters enter the fits and the resolution estimate.
  5. [Reference [39]] Reference [39] appears to contain an incomplete author name ('S.-C. A.'); please verify and correct the citation.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: the optical conductivity is a fitted parameter of an independent forward model, not an input disguised as a prediction.

full rationale

The paper's derivation chain is a forward model followed by a fit. The Fresnel coefficients (Eqs. 1-2) contain the optical conductivity σ and susceptibility χ as free parameters; the spin-orbit shift δ (Eq. 5) and the amplified pointer shifts (Eqs. 7-8) are derived from those coefficients. The monolayer conductivity is then extracted by fitting measured beam shifts to the strict expression Eq. (8), so the reported (0.993±0.005)σ0 is a fitted result rather than a value inserted into the model. The universal constant σ0 is used only as an external reference value, not as a fitting input. The susceptibility χ is adopted from Merano's independent fit (Ref. 27) and the paper explicitly shows its effect on the amplified shifts is negligible. The N-layer linear scaling is reported as an experimental observation for bilayer and trilayer samples; the text provides no equation defining N-layer conductivity as Nσ0 by construction, so no reduction to input can be exhibited. The paper contains self-citations (e.g., Refs. 25, 26, 29, 35, 36), but these support standard Fresnel-coefficient and angle-selection details and are not the load-bearing step; the detailed derivation of Eq. (8) is deferred to the Supplemental Material, which is an omitted proof rather than circularity. The internal inconsistency that Eq. (7) is said to fail for small β and is later used at β=2° to quote the 1.5×10⁻⁸ Ω⁻¹ resolution is a correctness/rigor concern, not a circularity, because that resolution number is not used as an input to the conductivity fit.

Assumptions & free parameters 2 free parameters · 4 assumptions · 0 invented entities

The central fit relies on the zero-thickness conducting-sheet model, the weak-coupling expansion, the assumption of a real universal monolayer conductivity, and the sample layer assignment. No new physical entities are introduced; the only data-fitted quantity is the conductivity, plus one externally fitted susceptibility parameter.

free parameters (2)
  • Graphene optical conductivity σ (in units of σ0) = monolayer: (0.993±0.005)σ0; bilayer ≈2σ0; trilayer ≈3σ0
    The central measured quantity, obtained by fitting Eq. (8) to the amplified shift versus postselection angle β for each sample.
  • Surface susceptibility χ = (8±3)×10^-10 m, from Merano, Ref. [27]
    An externally fitted parameter used in the Fresnel coefficients. The paper argues that varying χ over the cited range changes the pointer shift negligibly, so it is effectively fixed during the conductivity fit.
assumptions (4)
  • domain assumption Atomically thin crystals are modeled as zero-thickness two-dimensional conducting films with surface conductivity σ and susceptibility χ, leading to the Fresnel coefficients in Eqs. (1) and (2).
    Invoked at the start of the theory section; this is a standard model for graphene optics, supported by Refs. [27-29], but not re-derived in this paper.
  • domain assumption The paraxial approximation and weak-coupling condition kyδ << 1 hold for the 633 nm Gaussian beam.
    Used to convert the angular-spectrum reflection into the spin-dependent shift δ in Eqs. (3)-(5).
  • domain assumption Monolayer graphene has a real, universal optical conductivity σ0 at visible frequencies with no imaginary part.
    The fitting model assumes this universal-constant behavior, citing theory in Ref. [38]. The paper does not fit or test the no-imaginary-part assumption.
  • domain assumption The samples are untwisted monolayer, bilayer, and trilayer graphene, with layer counts correctly identified.
    The main text mentions only that Raman spectra confirm the graphene region; layer-count verification and stacking characterization are not shown. The monolayer value and the linear scaling result depend directly on this premise.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Precision Measurement of the Optical Conductivity of Atomically Thin Crystals via Photonic Spin Hall Effect." pith.science (2026). https://pith.science/paper/LPW7TIL4

@misc{pith2026190802043,
  author       = {Pith},
  title        = {Pith review of: Precision Measurement of the Optical Conductivity of Atomically Thin Crystals via Photonic Spin Hall Effect},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/LPW7TIL4}},
  note         = {Machine review of arXiv:1908.02043}
}
abstract

How to measure the optical conductivity of atomically thin crystals is an important but challenging issue due to the weak light-matter interaction at the atomic scale. Photonic spin Hall effect, as a fundamental physical effect in light-matter interaction, is extremely sensitive to the optical conductivity of atomically thin crystals. Here, we report a precision measurement of the optical conductivity of graphene, where the photonic spin Hall effect acts as a measurement pointer. By incorporating with the weak-value amplification technique, the optical conductivity of monolayer graphene taken as a universal constant of $(0.993\pm0.005)\sigma_0$ is detected, and a high measuring resolution with $1.5\times10^{-8}\Omega^{-1}$ is obtained. For few-layer graphene without twist, we find that the conductivities increase linearly with layer number. Our idea could provide an important measurement technique for probing other parameters of atomically thin crystals, such as magneto-optical constant, circular dichroism, and optical nonlinear coefficient.

Figures

Figures reproduced from arXiv: 1908.02043 by the authors.

Figure 1
Figure 1. FIG. 1: Illustration of photonic spin Hall e [PITH_FULL_IMAGE:figures/full_fig_p001_1.png] view at source ↗
Figure 2
Figure 2. FIG. 2: Amplification of the photonic spin Hall e [PITH_FULL_IMAGE:figures/full_fig_p002_2.png] view at source ↗
Figure 3
Figure 3. FIG. 3: Schematic of the experimental setup to detect the tin [PITH_FULL_IMAGE:figures/full_fig_p003_3.png] view at source ↗
Figures from the paper (1 more)
Figure 5
Figure 5. Figure 5: FIG. 5: Measurement of the optical conductivity in units of [PITH_FULL_IMAGE:figures/full_fig_p004_5.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

42 extracted references · 41 canonical work pages

  1. [27]

    S. Chen, C. Mi, L. Cai, M. Liu, H. Luo, and S. Wen, Appl. Phy s. Lett. 110, 031105 (2017)

  2. [1]

    1σ0, and 1

    9σ0, 1. 1σ0, and 1. 33σ0. The fitting curves are obtained based on three groups of data. For comparison, the result without gra phene is also given. via weak measurements. The above equation is the simplest form of the shift, which can explain the underlying physics of weak measurements clearly. However, it would fail to de- scribe the weak-value amplificat...

  3. [2]

    Bonaccorso, Z

    F. Bonaccorso, Z. Sun, T. Hasan, and A. C. Ferrari, Nat. Ph o- tonics 4, 611 (2010)

  4. [3]

    K. S. Novoselov, A. K. Geim, S. V . Morozov, D. Jiang, Y . Zhang, S. V . Dubonos, I. V . Grigorieva, and A. A. Firsov, Sci- ence 306, 666 (2004)

  5. [4]

    L. A. Falkovsky, J. Phys.: Conf. Ser. 129, 012004 (2008)

  6. [5]

    V . P . Gusynin, S. G. Sharapov, and J. P . Carbotte, Phys. Re v. Lett. 96, 256802 (2006)

  7. [6]

    T. Low, F. Guinea, H. Yan, F. Xia, and P . Avouris, Phys. Rev . Lett. 112, 116801 (2014)

  8. [7]

    L. A. Falkovsky and A. A. V arlamov, Eur. Phys. J. B 56, 284 (2007)

Show all 42 references
  1. [8]

    A. B. Kuzmenko, E. van Heumen, F. Carbone, and D. van der Marel, Phys. Rev. Lett. 100, 117401 (2008)

  2. [9]

    Ziegler, Phys

    K. Ziegler, Phys. Rev. B 75, 233407 (2007)

  3. [10]

    Stauber, N

    T. Stauber, N. M. R. Peres, and A. K. Geim, Phys. Rev. B 78, 085432 (2008)

  4. [11]

    R. R. Nair, P . Blake, A. N. Grigorenko, K. S. Novoselov, T . J. Booth, T. Stauber, N. M. R. Peres, and A. K. Geim, Science 320, 1308 (2008)

  5. [12]

    K. F. Mak, M. Y . Sfeir, Y . Wu, C. H. Lui, J. A. Misewich, and T. F. Heinz, Phys. Rev. Lett. 105, 136805 (2008)

  6. [13]

    J. M. Dawlaty, S. Shivaraman, J. Strait, P . George, M. Ch an- drashekhar, F. Rana, M. G. Spencer, D. V eksler, and Y . Chen, Appl. Phys. Lett. 93, 131905 (2008)

  7. [14]

    K. F. Mak, J. Shan, and T. F. Heinz, Phys. Rev. Lett. 106, 046401 (2011)

  8. [15]

    Onoda, S

    M. Onoda, S. Murakami, and N. Nagaosa, Phys. Rev. Lett. 93, 083901 (2004)

  9. [16]

    K. Y . Bliokh and Y . P . Bliokh, Phys. Rev. Lett. 96, 073903 (2006)

  10. [17]

    X. Yin, Z. Ye, J. Rho, Y . Wang, and X. Zhang, Science 339, 1405 (2013)

  11. [18]

    Shitrit, I

    N. Shitrit, I. Y ulevich, E. Maguid, D. Ozeri, D. V eksler , V . Kleiner, and E. Hasman, Science 340, 724 (2013)

  12. [19]

    K. Y . Bliokh, F. J. Rodr´ ıguez-Fortu˜ no, F. Nori, and A.V . Zayats, Nat. Photon. 9, 796 (2015)

  13. [20]

    X. Ling, X. Zhou, K. Huang, Y . Liu, C.-W. Qiu, H. Luo, and S . Wen, Rep. Prog. Phys. 80, 066401 (2017)

  14. [21]

    X. Zhou, Z. Xiao, H. Luo, and S. Wen, Phys. Rev. A 85, 043809 (2012)

  15. [22]

    Aharonov, D

    Y . Aharonov, D. Z. Albert, and L. V aidman, Phys. Rev. Lett. 60, 1351 (1988)

  16. [23]

    Hosten and P

    O. Hosten and P . Kwiat, Science 319, 787 (2008)

  17. [24]

    Blake, E

    P . Blake, E. W. Hill, A. H. Castro Neto, K. S. Novoselov, D . Jiang, R. Yang, T. J. Booth, and A. K. Geim, Appl. Phys. Lett. 91, 063124 (2007)

  18. [25]

    Bruna and S

    M. Bruna and S. Borini, Appl. Phys. Lett. 94, 031901 (2009)

  19. [26]

    X. Zhou, X. Ling, H. Luo, and S. Wen, Appl. Phys. Lett. 101, 251602 (2012)

  20. [28]

    Merano, Phys

    M. Merano, Phys. Rev. A 93, 013832 (2016)

  21. [29]

    W. J. M. Kort-Kamp, B. Amorim, G. Bastos, F. A. Pinheiro, F. S. S. Rosa, N. M. R. Peres, and C. Farina, Phys. Rev. B 92, 205415 (2015)

  22. [30]

    L. Cai, M. Liu, S. Chen, Y . Liu, W. Shu, H. Luo, and S. Wen, Phys. Rev. A 95, 013809 (2017)

  23. [31]

    A. G. Kofman, S. Ashhab, and F. Nori, Phys. Rep. 520, 43 (2012)

  24. [32]

    Dressel, M

    J. Dressel, M. Malik, F. M. Miatto, A. N. Jordan, and R. W. Boyd, Rev. Mod. Phys. 86, 307 (2014)

  25. [33]

    X.-Y . Xu, Y . Kedem, K. Sun, L. V aidman, C.-F. Li, and G.-C . Guo, Phys. Rev. Lett. 111, 033604 (2013)

  26. [34]

    A. N. Jordan, J. Mart´ ınez-Rinc´ on, and J. C. Howell, Phys. Rev. X 4, 011031 (2014)

  27. [35]

    Aiello and J

    A. Aiello and J. P . Woerdman, Opt. Lett. 33, 1437 (2008)

  28. [36]

    S. Chen, X. Zhou, C. Mi, H. Luo, and S. Wen, Phys. Rev. A 91, 062105 (2015)

  29. [37]

    M. Liu, L. Cai, S. Chen, Y . Liu, H. Luo, and S. Wen, Phys. Re v. A 95, 063827 (2017)

  30. [38]

    V . G. Kravets, A. N. Grigorenko, R. R. Nair, P . Blake, S. A nis- simova, K. S. Novoselov, and A. K. Geim, Phys. Rev. B 81, 155413 (2010)

  31. [39]

    S. A. Mikhailov and K. Ziegler, Phys. Rev. Lett. 99, 016803 (2007)

  32. [40]

    Kim, S.-C

    C.-J. Kim, S.-C. A., Z. Ziegler, Y . Ogawa, C. Noguez, and J. Park, Nat. Nanotechnol. 11, 520 (2016)

  33. [41]

    Y . Cao, V . Fatemi, S. Fang, K. Watanabe, T. Taniguchi, E.Kaxi- ras, and P . Jarillo-Herrero, Nature (London) 556, 43 (2018)

  34. [42]

    W. J. M. Kort-Kamp, F. J. Culchac, R. B. Capaz, and F. A. Pinheiro, Phys. Rev. B 98, 195431 (2018)

Pith tools

Reviewed August 14, 2026 · model on record in the stance chip above.