Pith. sign in

REVIEW 2 major objections 4 minor 62 references

Alternative Derivations of Hawking Radiation

T0 review · 2 major / 4 minor · reviewed 2026-08-07 · deepseek-v4-flash

Pith's one-line read A review of three independent semiclassical derivations shows they all recover the Hawking temperature $T_H=1/(8\pi M)$ for a Schwarzschild black hole.

desk verdict A transparent review of three standard derivations of Hawking radiation that earns its keep through honest acknowledgment of where each method leans on unproven sign choices. read the letter →

arxiv 2505.19691 v1 pith:PS5SXHVR submitted 2025-05-26 gr-qc

classification gr-qc PACS 04.70.Dy04.62.+v
keywords HawkingradiationblackholetemperaturetunnelingmethodgravitationalanomalytraceGreen'sfunctioncomplexifiedspacetimesemiclassicalgravity
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This review chapter argues that three semiclassical routes to Hawking radiation—particle tunneling across the horizon, gravitational and trace anomalies in a $(1+1)$-dimensional effective theory, and the analytic thermal structure of Green's functions—are valid alternative derivations, each recovering the standard Hawking temperature $T_H=1/(8\pi M)$ for a Schwarzschild black hole. The point is not to introduce a new computation but to show that different physical pictures of the same effect are consistent and mutually reinforcing. A reader comes away with a map of where each method's assumptions live, including the $i\varepsilon$ sign in tunneling, the sign of the chiral anomaly flux, and the complex-time analyticity behind the propagator. The chapter also notes, candidly, which steps are heuristic rather than proved.

What carries the argument

The machinery differs per method, but a single thread runs through all three: the horizon is a pole, and the correct way around the pole is fixed by complex analyticity. In the tunneling method the pole is in the integrand $[1-(2H/r)]^{-1}$ at $r=2H$, and the $i\varepsilon$ prescription (plus the complex path $t\to t-4Mi\theta$ in the maximal extension) converts it into $i\pi\delta(1-\sqrt{2H/r})$, giving $\operatorname{Im}S=4\pi(M-\omega/2)\omega$. In the anomaly method the machinery is the $(1+1)$-dimensional chiral reduction near the horizon together with the covariant gravitational anomaly $\nabla_\mu \tilde{T}^{(\chi)\mu}{}_\nu = -\eta (1/96\pi)\varepsilon_{\mu\nu}\partial^\mu R$, whose cancellation fixes the outgoing flux. In the Green's function method the machinery is the analyticity of $G_F$ in a strip $-4\pi M\le \operatorname{Im}t\le 0$ and its periodicity in imaginary time with period $8\pi M$, from which $P_{\rm emit}=e^{-8\pi ME}P_{\rm absorb}$ follows. Each method isolates a different manifestation of the same complexified Schwarzschild geometry.

What would settle it

Evaluate Eq. (1.16) with the opposite $i\varepsilon$ sign ($r\to r+i\varepsilon$) while keeping the Hamiltonian contour unchanged: the imaginary part becomes $-4\pi(M-\omega/2)\omega$, so the probability is $e^{+8\pi(M-\omega/2)\omega}$, the inverse of the claimed Boltzmann factor; that would directly refute the tunneling derivation as presented.

Watch

Extended reading notes

Core claim

The central claim, stated on the chapter's own terms, is that the Hawking effect can be derived without Bogoliubov transformations: the tunneling method obtains $\Gamma=e^{-8\pi(M-\omega/2)\omega}$ from the imaginary part of the action, giving $T_H=1/(8\pi M)$ at leading order; the gravitational-anomaly method cancels the chiral anomaly near the horizon with a flux whose magnitude $\kappa^2/(48\pi)$ equals that of thermal radiation with $T=\kappa/(2\pi)$; and the Green's function method derives $P_{\rm emit}=e^{-8\pi ME}P_{\rm absorb}$ from the strip analyticity of the Feynman propagator. In the chapter's view, these are not competing explanations but complementary windows on the same semiclassical phenomenon.

Load-bearing premise

The load-bearing premise is the sign of the $i\varepsilon$ prescription in the tunneling action (1.17), which the chapter admits is only heuristically justified, since a wrong sign flips the imaginary part and turns the Boltzmann factor $e^{-8\pi M\omega}$ into its inverse $e^{+8\pi M\omega}$.

Editorial extensions

If this is right

  • All three methods reproduce $T_H=1/(8\pi M)$, so the Hawking temperature is not an artifact of Bogoliubov coefficients but a robust semiclassical feature.
  • The tunneling derivation with energy conservation yields $\Gamma=e^{-8\pi(M-\omega/2)\omega}=e^{\Delta S_{\rm BH}}$, predicting a correction to the Boltzmann factor at next order in $\omega$.
  • The gravitational-anomaly method fixes the outgoing flux $T^r_t=-\kappa^2/(48\pi)$, matching a $(1+1)$-dimensional thermal flux with $T=\kappa/(2\pi)$.
  • The Green's function method yields $P_{\rm emit}=e^{-8\pi ME}P_{\rm absorb}$, directly showing the Boltzmann factor from complex-time analyticity.
  • The tunneling method is the WKB limit of the path-integral Green's function method, connecting the probability and propagation pictures.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Because all three derivations require an analytic continuation through complex time or a complex path, one might expect that any semiclassical derivation of Hawking radiation must contain such a continuation; the chapter observes the connection but does not elevate it to a theorem.
  • The sign discrepancy $\eta=\pm1$ in the gravitational-anomaly literature is resolved by a boundary condition at the horizon; a testable extension would be to compute the same flux in a setting where the boundary condition is independently fixed, and see whether $\eta=-1$ remains forced.
  • The chapter's comparison suggests applying the three methods to Rindler spacetime, where tunneling and anomaly are reported to disagree, could pinpoint which assumption (e.g., back-reaction or horizon boundary condition) is responsible for the discrepancy.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

2 major / 4 minor

Summary. This book chapter presents three families of alternative derivations of Hawking radiation for a Schwarzschild black hole: the tunneling method (Parikh-Wilczek null geodesic and Hamilton-Jacobi variants), the anomaly method (gravitational and trace anomaly versions), and the Green's function/Hartle-Hawking path-integral method. Each derivation is worked out in detail and leads to the standard Hawking temperature T_H = 1/(8πM) (or surface gravity κ/2π). The chapter also compares the methods, discusses their mutual relations, and is unusually explicit about conditions that are imposed rather than derived, such as the iε prescription in the tunneling calculation, the vanishing of the covariant energy-momentum tensor at the horizon, and the heuristic nature of the chirality connection.

Significance. The chapter is a pedagogical review rather than a presentation of new results. Its value lies in collecting three influential semiclassical derivations, reproducing them step by step, and making their assumptions visible. The Green's function/Hartle-Hawking derivation is the most self-contained and is presented cleanly. The author deserves credit for explicitly flagging the weak points of the tunneling and anomaly methods, including in footnote 5 and in the remarks in Sec. 1.3.3. If the claims are appropriately qualified, the chapter can serve as a useful reference for students and researchers; the main weakness is that the abstract and conclusion state the derivations as fully valid, while the body concedes load-bearing conditions that are not derived.

major comments (2)
  1. [Sec. 1.2.1, Eq. (1.17), with Sec. 1.2.2 and footnote 5] The sign of the iε prescription is load-bearing for the tunneling derivation. Eq. (1.17) shows that H → H + iε (or r → r − iε) gives Im S = 4π(M − ω/2)ω, while flipping ε → −ε gives minus this value, which would invert the Boltzmann factor and destroy the physical Hawking result. The complex-Kruskal path in Eqs. (1.29)-(1.30) is presented as fixing the sign, but the author concedes in footnote 5 that the connection between the complex continuation and the iε prescription is not rigorously justified. As written, the tunneling method reproduces T_H only under a sign convention that is itself chosen to produce the known answer. The manuscript should either provide an independent derivation of the sign (for example, from positive-frequency conditions or from a more rigorous analytic continuation) or explicitly weaken the claim that the method is a fully self-contained alternative derivation of Hawking radiation.
  2. [Sec. 1.3.3, Eq. (1.95)] The gravitational-anomaly derivation fixes the integration constant Kχ by imposing the vanishing of the covariant energy-momentum tensor at the horizon, ~T^(χ)_{μν}|_{r_H} = 0. This condition is not derived within the anomaly framework; it is an additional boundary-condition assumption that is essential for obtaining the flux in Eq. (1.96) and hence the Hawking temperature. The author is transparent that this is imposed, and Sec. 1.3.4 offers a consistency check via the trace-anomaly method, but the anomaly method is therefore not self-contained in the way the abstract implies. The text should state explicitly that this is an independent regularity/vacuum assumption and discuss its physical status, rather than presenting it as a consequence of the anomaly equations.
minor comments (4)
  1. [Eq. (1.95), Sec. 1.3.3] The sentence 'r0 is determined by f′(r0) = f″(r0) = 0' is incorrect for the Schwarzschild metric f(r) = 1 − 2M/r, since no finite r0 satisfies both conditions. The intended statement is that the boundary term is evaluated in the asymptotically flat region at infinity; this should be corrected for clarity.
  2. [Sec. 1.3.3, Remark on the original derivation] The remark correctly notes that the total-derivative term ∂_r(N^r_t H) in the original Robinson-Wilczek treatment is assumed to vanish and that the author does not know of an explicit justification. Because the main derivation avoids this issue by invoking the incoming-mode cancellation in Eqs. (1.88)-(1.90), this does not block the main result, but the text should clarify that the status of the original derivation's total-derivative term remains an open issue rather than a settled step.
  3. [Sec. 1.5] The chirality connection between the tunneling and anomaly methods is explicitly described as heuristic and 'not manifest' when matching variables. This is an honest assessment, but the phrasing in the bullet list should make clear that this connection is an observation or conjecture, not a derivation, to avoid overstating the consistency of the three methods.
  4. [Eq. (1.122), Sec. 1.4.1] In the definition of the time-ordered thermal Green's function, the condition '|Im(t′ − t′)| < β' should read '|Im(t − t′)| < β'.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: each method computes T_H from independent geometric/QFT inputs; the iε sign is an acknowledged gap, not a fitted result.

full rationale

This chapter is a review of three alternative derivations of Hawking radiation. In each case the Hawking temperature is computed from the Schwarzschild geometry and standard QFT ingredients rather than inserted as input. In the tunneling method, Im S = 4π(M − ω/2)ω follows from the geodesic/Hamilton–Jacobi action and a contour prescription; the leading-order Boltzmann factor then yields T_H = 1/(8πM). The iε sign is the only delicate step: the paper itself states in Sec. 1.2.1 that flipping ε → −ε changes the sign of Im S, and it flags this in the closing remarks. However, the sign is not fitted to the known temperature; Sec. 1.2.2 gives an independent complex-path justification via the Kruskal continuation (1.29)-(1.30), and footnote 5 candidly notes that a better justification connecting the t and r continuations is still desirable. That is a technical/regularization gap, not a circular reduction: no equation defining the result is reused as an input. In the anomaly method, the flux |T^r_t| = κ²/48π is derived from the chiral gravitational anomaly plus a horizon boundary condition (vanishing covariant energy-momentum tensor), and the temperature follows by comparing this flux with the known thermal flux Φ_Th = πT²/12. The boundary condition is motivated by regularity and by consistency with the trace-anomaly method, not chosen to force T_H = κ/(2π). In the Green's function method, the KMS period 8πM is read off from the Kruskal coordinate identifications, and the emission-to-absorption amplitude ratio gives e^{−8πME}, whose comparison with e^{−E/T_H} yields T_H = 1/(8πM). No parameter is fitted to T_H, no central premise is justified solely by a self-citation (the author is not among the cited works), and no known result is merely renamed. The derivations are self-contained in the sense required here, with admitted heuristic steps that affect rigor but not circularity.

Assumptions & free parameters 0 free parameters · 5 assumptions · 0 invented entities

The chapter introduces no free parameters or invented entities. The central derivations rely on standard semiclassical quantum gravity techniques (WKB, dimensional reduction near the horizon, anomaly structure, analytic continuation to the Euclidean section). The two ad hoc assumptions flagged in the ledger are the sign of the iε prescription and the horizon boundary condition for the covariant energy-momentum tensor, both of which the author acknowledges require better justification.

assumptions (5)
  • domain assumption WKB approximation φ(t_p, r) ≈ exp(iS(t_p, r)) for field modes near the horizon, valid in the geometric optics limit.
    Used in the tunneling method (Eq. (1.10)) to relate the tunneling probability to the imaginary part of the classical action.
  • ad hoc to paper The iε prescription (H → H + iε or r → r − iε) determines the sign of the imaginary part of the action integral.
    The sign is not derived; the author notes (Sec. 1.2.1) that flipping ε → −ε flips the sign of Im S. The analytic continuation via the Kruskal extension (Eq. (1.29)) is used to justify the chosen sign, but the author describes this as a demonstration rather than a proof.
  • domain assumption Near the horizon, the scalar field reduces to a free (1+1)-dimensional massless theory in the r−t section, and ingoing modes can be discarded leaving a chiral theory.
    Basis of the anomaly method; the near-horizon metric suppresses terms with f(r) (Eqs. (1.45)-(1.46)), and the recipe (Sec. 1.3) states that ingoing modes cannot affect the outside effective theory.
  • ad hoc to paper The covariant energy-momentum tensor of the chiral theory vanishes at the horizon, used to fix the integration constant Kχ.
    Imposed boundary condition in Eq. (1.95); the author notes it corresponds to requiring regularity for a freely falling observer, but it is not derived within the anomaly method.
  • domain assumption The Feynman propagator is analytic in the strip −4πM ≤ Im t ≤ 0, and periodic in imaginary time with period 8πM, established by the singularity structure of null geodesics.
    Used in the Green's function method to derive the Boltzmann factor (Eqs. (1.145)-(1.156)); the analyticity is argued from the WKB form of the short-time propagator.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Alternative Derivations of Hawking Radiation." pith.science (2026). https://pith.science/paper/PS5SXHVR

@misc{pith2026250519691,
  author       = {Pith},
  title        = {Pith review of: Alternative Derivations of Hawking Radiation},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/PS5SXHVR}},
  note         = {Machine review of arXiv:2505.19691}
}
abstract

Since the original derivation of Hawking radiation, there have been lots of alternative approaches to show the same fact that black holes emit particles as hot bodies with a temperature. These alternative methods generally rely on different conditions and physical quantities to manifest the radiation, providing various points of view of this effect in the intersection of gravity and quantum theory. This chapter presents some alternative derivations of Hawking radiation in the literature, including the tunneling, anomaly and Green's function methods. From these methods, various features of the black hole system can be seen, such as the gravitational and trace anomalies of the $(1+1)$-dimensional effective theory and the analytical continuation of the complexified spacetime.

Figures

Figures reproduced from arXiv: 2505.19691 by the authors.

Figure 1.1
Figure 1.1. A Schwarzschild black hole with the Kruskal extension. The dashed path [PITH_FULL_IMAGE:figures/full_fig_p009_1_1.png] view at source ↗
Figure 1.2
Figure 1.2. The time ordering defined in (1.122) agrees with the analytic continuation. iβ) < β), the thermal Green’s function with the time ordering (1.122) is GT (t +iβ,x;t ′ ,x ′ ) = G − T (t +iβ,x;t ′ ,x ′ ) = G + T (t,x;t ′ ,x ′ ) = GT (t,x;t ′ ,x ′ ), (1.123) where (1.119) is applied. Similarly, for Im(t−t ′ ) = ε (making Im(t−t ′−iβ) > −β), GT (t −iβ,x;t ′ ,x ′ ) = G + T (t −iβ,x;t ′ ,x ′ ) = G − T (t,x;t ′ ,x ′ ) = GT (… view at source ↗
Figure 1.3
Figure 1.3. The Penrose diagram for a Schwarzschild black hole. We denote [PITH_FULL_IMAGE:figures/full_fig_p034_1_3.png] view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

62 extracted references · 29 canonical work pages

  1. [1]

    Comments on anomaly versus WKB/tunneling methods for calculating Unruh radiation

    V . Akhmedova, T. Pilling, A. de Gill and D. Singleton, “Comments on anomaly versus WKB/tunneling methods for calculating Unruh radiation,” Phys. Lett. B 673, 227-231 (2009) doi:10.1016/j.physletb.2009.02.022 [arXiv:0808.3413 [hep-th]]

  2. [2]

    Gravitational Anomalies,

    L. Alvarez-Gaume and E. Witten, “Gravitational Anomalies,” Nucl. Phys. B 234, 269 (1984) doi:10.1016/0550-3213(84)90066-X

  3. [3]

    Hawking Radiation as Tunneling for Extremal and Rotating Black Holes

    M. Angheben, M. Nadalini, L. Vanzo and S. Zerbini, “Hawking radiation as tunneling for extremal and rotating black holes,” JHEP05, 014 (2005) doi:10.1088/1126-6708/2005/05/014 [arXiv:hep-th/0503081 [hep-th]]

  4. [4]

    Minimal conditions for the existence of a Hawking-like flux,

    C. Barcelo, S. Liberati, S. Sonego and M. Visser, “Minimal conditions for the existence of a Hawking-like flux,” Phys. Rev. D 83, 041501 (2011) doi:10.1103/PhysRevD.83.041501 [arXiv:1011.5593 [gr-qc]]

  5. [5]

    Hawking Radiation and Covariant Anomalies

    R. Banerjee and S. Kulkarni, “Hawking radiation and covariant anomalies,” Phys. Rev. D 77, 024018 (2008) doi:10.1103/PhysRevD.77.024018 [arXiv:0707.2449 [hep-th]]

  6. [6]

    Connecting anomaly and tunneling methods for Hawking ef- fect through chirality,

    R. Banerjee and B. R. Majhi, “Connecting anomaly and tunneling methods for Hawking ef- fect through chirality,” Phys. Rev. D 79, 064024 (2009) doi:10.1103/PhysRevD.79.064024 [arXiv:0812.0497 [hep-th]]

  7. [7]

    Hawking black body spectrum from tunneling mechanism,

    R. Banerjee and B. R. Majhi, “Hawking black body spectrum from tunneling mechanism,” Phys. Lett. B 675, 243-245 (2009) doi:10.1016/j.physletb.2009.04.005 [arXiv:0903.0250 [hep-th]]

  8. [8]

    Consistent and Covariant Anomalies in Gauge and Gravita- tional Theories,

    W. A. Bardeen and B. Zumino, “Consistent and Covariant Anomalies in Gauge and Gravita- tional Theories,” Nucl. Phys. B 244, 421-453 (1984) doi:10.1016/0550-3213(84)90322-5

Show all 62 references
  1. [9]

    Two-dimensional gravitational anomalies, Schwinger terms and dispersion relations,

    R. A. Bertlmann and E. Kohlprath, “Two-dimensional gravitational anomalies, Schwinger terms and dispersion relations,” Annals Phys. 288, 137-163 (2001) doi:10.1006/aphy.2000.6110 [arXiv:hep-th/0011067 [hep-th]]

  2. [10]

    Quantum Fields in Curved Space,

    N. D. Birrell and P. C. W. Davies, “Quantum Fields in Curved Space,” Cambridge Univ. Press, 1984, ISBN 978-0-521-27858-4, 978-0-521-27858-4 doi:10.1017/CBO9780511622632

  3. [11]

    A Primer for black hole quantum physics,

    R. Brout, S. Massar, R. Parentani and P. Spindel, “A Primer for black hole quantum physics,” Phys. Rept. 260, 329-454 (1995) doi:10.1016/0370-1573(95)00008-5 [arXiv:0710.4345 [gr- qc]]

  4. [12]

    Black Hole Thermodynamics,

    S. Carlip, “Black Hole Thermodynamics,” Int. J. Mod. Phys. D 23, 1430023 (2014) doi:10.1142/S0218271814300237 [arXiv:1410.1486 [gr-qc]]

  5. [13]

    Path Integral Quantization and Cosmological Particle Produc- tion: An Example,

    D. M. Chitre and J. B. Hartle, “Path Integral Quantization and Cosmological Particle Produc- tion: An Example,” Phys. Rev. D16, 251-260 (1977) doi:10.1103/PhysRevD.16.251

  6. [14]

    Trace Anomalies and the Hawking Effect,

    S. M. Christensen and S. A. Fulling, “Trace Anomalies and the Hawking Effect,” Phys. Rev. D 15, 2088-2104 (1977) doi:10.1103/PhysRevD.15.2088

  7. [15]

    Black Hole Evaporation in the Klein-Sauter-Heisenberg-Euler Formalism,

    T. Damour and R. Ruffini, “Black Hole Evaporation in the Klein-Sauter-Heisenberg-Euler Formalism,” Phys. Rev. D14, 332-334 (1976) doi:10.1103/PhysRevD.14.332

  8. [16]

    Gravitational anomalies: A Recipe for Hawk- ing radiation,

    S. Das, S. P. Robinson and E. C. Vagenas, “Gravitational anomalies: A Recipe for Hawk- ing radiation,” Int. J. Mod. Phys. D 17, 533-539 (2008) doi:10.1142/S0218271808012218 [arXiv:0705.2233 [hep-th]]. 1 Alternative Derivations of Hawking Radiation 39

  9. [17]

    Energy Momentum Tensor Near an Evapo- rating Black Hole,

    P. C. W. Davies, S. A. Fulling and W. G. Unruh, “Energy Momentum Tensor Near an Evapo- rating Black Hole,” Phys. Rev. D13, 2720-2723 (1976) doi:10.1103/PhysRevD.13.2720

  10. [18]

    Quantum vacuum energy in two dimensional space-times,

    P. C. W. Davies and S. A. Fulling, “Quantum vacuum energy in two dimensional space-times,” Proc. Roy. Soc. Lond. A 354 (1977) 59 doi:10.1098/rspa.1977.0056

  11. [19]

    Quantum field theory in curved space-time,

    L. H. Ford, “Quantum field theory in curved space-time,” [arXiv:gr-qc/9707062 [gr-qc]]

  12. [20]

    Cosmological particle production: a review,

    L. H. Ford, “Cosmological particle production: a review,” Rept. Prog. Phys.84, no.11, 116901 (2021) doi:10.1088/1361-6633/ac1b23 [arXiv:2112.02444 [gr-qc]]

  13. [21]

    The Gravitational Anomaly: An Elementary, Coordinate Space Approach,

    S. A. Fulling, “The Gravitational Anomaly: An Elementary, Coordinate Space Approach,” Gen. Rel. Grav. 18, 609-615 (1986) doi:10.1007/BF00769929

  14. [22]

    Temperature, periodicity and horizons,

    S. A. Fulling and S. N. M. Ruijsenaars, “Temperature, periodicity and horizons,” Phys. Rept. 152, 135-176 (1987) doi:10.1016/0370-1573(87)90136-0

  15. [23]

    Black Holes in Thermal Equilibrium,

    G. W. Gibbons and M. J. Perry, “Black Holes in Thermal Equilibrium,” Phys. Rev. Lett. 36, 985 (1976) doi:10.1103/PhysRevLett.36.985

  16. [24]

    Black Holes and Thermal Green’s Functions,

    G. W. Gibbons and M. J. Perry, “Black Holes and Thermal Green’s Functions,” Proc. Roy. Soc. Lond. A 358, 467-494 (1978) doi:10.1098/rspa.1978.0022

  17. [25]

    Cosmological Event Horizons, Thermodynamics, and Particle Creation,

    G. W. Gibbons and S. W. Hawking, “Cosmological Event Horizons, Thermodynamics, and Particle Creation,” Phys. Rev. D15, 2738-2751 (1977) doi:10.1103/PhysRevD.15.2738

  18. [26]

    Allgemeine L ¨osung des statischen Eink ¨orperproblems in der Einsteinschen Gravitationstheorie,

    A. Gullstrand, “Allgemeine L ¨osung des statischen Eink ¨orperproblems in der Einsteinschen Gravitationstheorie,” Almqvist & Wiksell, 1922,

  19. [27]

    Path Integral Derivation of Black Hole Radiance,

    J. B. Hartle and S. W. Hawking, “Path Integral Derivation of Black Hole Radiance,” Phys. Rev. D 13, 2188-2203 (1976) doi:10.1103/PhysRevD.13.2188

  20. [28]

    Black hole explosions,

    S. W. Hawking, “Black hole explosions,” Nature 248, 30-31 (1974) doi:10.1038/248030a0

  21. [29]

    Particle Creation by Black Holes,

    S. W. Hawking, “Particle Creation by Black Holes,” Commun. Math. Phys.43, 199-220 (1975) [erratum: Commun. Math. Phys. 46, 206 (1976)] doi:10.1007/BF02345020

  22. [30]

    Hawking radiation from charged black holes via gauge and gravitational anomalies,

    S. Iso, H. Umetsu and F. Wilczek, “Hawking radiation from charged black holes via gauge and gravitational anomalies,” Phys. Rev. Lett. 96, 151302 (2006) doi:10.1103/PhysRevLett.96.151302 [arXiv:hep-th/0602146 [hep-th]]

  23. [31]

    Anomalies, Hawking radiations and regularity in rotating black holes,

    S. Iso, H. Umetsu and F. Wilczek, “Anomalies, Hawking radiations and regularity in rotating black holes,” Phys. Rev. D 74, 044017 (2006) doi:10.1103/PhysRevD.74.044017 [arXiv:hep- th/0606018 [hep-th]]

  24. [32]

    Quantum Anomalies at Horizon and Hawking Radia- tions in Myers-Perry Black Holes,

    S. Iso, T. Morita and H. Umetsu, “Quantum Anomalies at Horizon and Hawking Radia- tions in Myers-Perry Black Holes,” JHEP04, 068 (2007) doi:10.1088/1126-6708/2007/04/068 [arXiv:hep-th/0612286 [hep-th]]

  25. [33]

    Fluxes of higher-spin currents and Hawking radiations from charged black holes,

    S. Iso, T. Morita and H. Umetsu, “Fluxes of higher-spin currents and Hawking radiations from charged black holes,” Phys. Rev. D76, 064015 (2007) doi:10.1103/PhysRevD.76.064015 [arXiv:0705.3494 [hep-th]]

  26. [34]

    Higher-spin Currents and Thermal Flux from Hawking Radiation,

    S. Iso, T. Morita and H. Umetsu, “Higher-spin Currents and Thermal Flux from Hawking Radiation,” Phys. Rev. D 75, 124004 (2007) doi:10.1103/PhysRevD.75.124004 [arXiv:hep- th/0701272 [hep-th]]

  27. [35]

    Hawking Radiation, Gravitational Anomaly and Conformal Symmetry: The Origin of Universality,

    S. Iso, “Hawking Radiation, Gravitational Anomaly and Conformal Symmetry: The Origin of Universality,” Int. J. Mod. Phys. A 23, 2082-2090 (2008) doi:10.1142/S0217751X08040627 [arXiv:0804.0652 [hep-th]]

  28. [36]

    Gravitational collapse in Painleve-Gullstrand coordinates,

    Y . Kanai, M. Siino and A. Hosoya, “Gravitational collapse in Painleve-Gullstrand coordinates,” Prog. Theor. Phys. 125, 1053-1065 (2011) doi:10.1143/PTP.125.1053 [arXiv:1008.0470 [gr-qc]]

  29. [37]

    Selfinteraction correction to black hole radiance,

    P. Kraus and F. Wilczek, “Selfinteraction correction to black hole radiance,” Nucl. Phys. B 433, 403-420 (1995) doi:10.1016/0550-3213(94)00411-7 [arXiv:gr-qc/9408003 [gr-qc]]

  30. [38]

    Statistical mechanical theory of irreversible processes. 1. General theory and simple applications in magnetic and conduction problems,

    R. Kubo, “Statistical mechanical theory of irreversible processes. 1. General theory and simple applications in magnetic and conduction problems,” J. Phys. Soc. Jap. 12, 570-586 (1957) doi:10.1143/JPSJ.12.570

  31. [39]

    Theory of many particle systems. 1.,

    P. C. Martin and J. S. Schwinger, “Theory of many particle systems. 1.,” Phys. Rev. 115, 1342-1373 (1959) doi:10.1103/PhysRev.115.1342

  32. [40]

    On the definition and approximation of Feynman’s path integrals,

    C. Morette, “On the definition and approximation of Feynman’s path integrals,” Phys. Rev.81, 848-852 (1951) doi:10.1103/PhysRev.81.848 40 Chon Man Sou

  33. [41]

    Hawking radiation from rotating black holes and gravitational anomalies,

    K. Murata and J. Soda, “Hawking radiation from rotating black holes and gravitational anomalies,” Phys. Rev. D 74, 044018 (2006) doi:10.1103/PhysRevD.74.044018 [arXiv:hep- th/0606069 [hep-th]]

  34. [42]

    Entropy of horizons, complex paths and quantum tunneling,

    T. Padmanabhan, “Entropy of horizons, complex paths and quantum tunneling,” Mod. Phys. Lett. A 19, 2637-2643 (2004) doi:10.1142/S0217732304015257 [arXiv:gr-qc/0405072 [gr- qc]]

  35. [43]

    Quantum Field Theory in Curved Spacetime: Quantized Field and Gravity,

    L. E. Parker and D. Toms, “Quantum Field Theory in Curved Spacetime: Quantized Field and Gravity,” Cambridge University Press, 2009, ISBN 978-0-521-87787-9, 978-0-521-87787-9, 978-0-511-60155-2 doi:10.1017/CBO9780511813924

  36. [44]

    Hawking radiation as tunneling,

    M. K. Parikh and F. Wilczek, “Hawking radiation as tunneling,” Phys. Rev. Lett. 85, 5042- 5045 (2000) doi:10.1103/PhysRevLett.85.5042 [arXiv:hep-th/9907001 [hep-th]]

  37. [45]

    Energy conservation and Hawking radiation,

    M. K. Parikh, “Energy conservation and Hawking radiation,” doi:10.1142/9789812704030 0155 [arXiv:hep-th/0402166 [hep-th]]

  38. [46]

    A Secret tunnel through the horizon,

    M. K. Parikh, “A Secret tunnel through the horizon,” Int. J. Mod. Phys. D 13, 2351-2354 (2004) doi:10.1142/S0218271804006498 [arXiv:hep-th/0405160 [hep-th]]

  39. [47]

    Probability Distribution of Particles Created by a Black Hole,

    L. Parker, “Probability Distribution of Particles Created by a Black Hole,” Phys. Rev. D 12, 1519-1525 (1975) doi:10.1103/PhysRevD.12.1519

  40. [48]

    Painlev ´e, ”La m ´ecanique classique et la th ´eorie de la relativit ´e,” C

    P. Painlev ´e, ”La m ´ecanique classique et la th ´eorie de la relativit ´e,” C. R. Acad. Sci. (Paris) 173, 677–680 (1921)

  41. [49]

    A Relationship between Hawking radiation and gravita- tional anomalies,

    S. P. Robinson and F. Wilczek, “A Relationship between Hawking radiation and gravita- tional anomalies,” Phys. Rev. Lett. 95, 011303 (2005) doi:10.1103/PhysRevLett.95.011303 [arXiv:gr-qc/0502074 [gr-qc]]

  42. [50]

    Two quantum effects in the theory of gravitation,

    S. P. Robinson, “Two quantum effects in the theory of gravitation,”

  43. [51]

    On gauge invariance and vacuum polarization,

    J. S. Schwinger, “On gauge invariance and vacuum polarization,” Phys. Rev. 82, 664-679 (1951) doi:10.1103/PhysRev.82.664

  44. [52]

    Quantum Field Theory and the Standard Model,

    M. D. Schwartz, “Quantum Field Theory and the Standard Model,” Cambridge University Press, 2014, ISBN 978-1-107-03473-0, 978-1-107-03473-0

  45. [53]

    Method of complex paths and general covariance of Hawking radiation,

    S. Shankaranarayanan, K. Srinivasan and T. Padmanabhan, “Method of complex paths and general covariance of Hawking radiation,” Mod. Phys. Lett. A 16, 571-578 (2001) doi:10.1142/S0217732301003632 [arXiv:gr-qc/0007022 [gr-qc]]

  46. [54]

    Hawking radiation in different coordinate settings: Complex paths approach,

    S. Shankaranarayanan, T. Padmanabhan and K. Srinivasan, “Hawking radiation in different coordinate settings: Complex paths approach,” Class. Quant. Grav. 19, 2671-2688 (2002) doi:10.1088/0264-9381/19/10/310 [arXiv:gr-qc/0010042 [gr-qc]]

  47. [55]

    Particle production and complex path analysis,

    K. Srinivasan and T. Padmanabhan, “Particle production and complex path analysis,” Phys. Rev. D 60, 024007 (1999) doi:10.1103/PhysRevD.60.024007 [arXiv:gr-qc/9812028 [gr-qc]]

  48. [56]

    Thermal Effects for an Accelerating Observer,

    W. Troost and H. Van Dam, “Thermal Effects for an Accelerating Observer,” Phys. Lett. B71, 149-152 (1977) doi:10.1016/0370-2693(77)90764-X

  49. [57]

    Thermal Propagators and Accelerated Frames of Reference,

    W. Troost and H. van Dam, “Thermal Propagators and Accelerated Frames of Reference,” Nucl. Phys. B 152, 442-460 (1979) doi:10.1016/0550-3213(79)90091-9

  50. [58]

    Notes on black hole evaporation,

    W. G. Unruh, “Notes on black hole evaporation,” Phys. Rev. D 14, 870 (1976) doi:10.1103/PhysRevD.14.870

  51. [59]

    Gravitational anomalies, Hawking radiation, and spherically sym- metric black holes,

    E. C. Vagenas and S. Das, “Gravitational anomalies, Hawking radiation, and spherically sym- metric black holes,” JHEP 10, 025 (2006) doi:10.1088/1126-6708/2006/10/025 [arXiv:hep- th/0606077 [hep-th]]

  52. [60]

    Tunnelling Methods and Hawking’s radia- tion: achievements and prospects,

    L. Vanzo, G. Acquaviva and R. Di Criscienzo, “Tunnelling Methods and Hawking’s radia- tion: achievements and prospects,” Class. Quant. Grav. 28, 183001 (2011) doi:10.1088/0264- 9381/28/18/183001 [arXiv:1106.4153 [gr-qc]]

  53. [61]

    On tunneling across horizons,

    L. Vanzo, “On tunneling across horizons,” EPL 95, no.2, 20001 (2011) doi:10.1209/0295- 5075/95/20001 [arXiv:1104.1569 [gr-qc]]

  54. [62]

    On Particle Creation by Black Holes,

    R. M. Wald, “On Particle Creation by Black Holes,” Commun. Math. Phys. 45, 9-34 (1975) doi:10.1007/BF01609863

Pith tools

Reviewed August 7, 2026 · model on record in the stance chip above.