pith. sign in

arxiv: 1511.01239 · v3 · pith:QJVJZZQQnew · submitted 2015-11-04 · 🧬 q-bio.MN · cond-mat.dis-nn· cs.SI· nlin.AO· physics.bio-ph

Plasticity-rigidity cycles: A general adaptation mechanism

classification 🧬 q-bio.MN cond-mat.dis-nncs.SInlin.AOphysics.bio-ph
keywords adaptationcyclesplasticity-rigidityecosystemsgeneralmechanismwelladaptive
0
0 comments X
read the original abstract

Successful adaptation helped the emergence of complexity. Alternating plastic- and rigid-like states were recurrently considered to play a role in adaptive processes. However, this extensive knowledge remained fragmented. In this paper I describe plasticity-rigidity cycles as a general adaptation mechanism operating in molecular assemblies, assisted protein folding, cellular differentiation, learning, memory formation, creative thinking, as well as the organization of social groups and ecosystems. Plasticity-rigidity cycles enable a novel understanding of aging, exploration/exploitation trade-off and evolvability, as well as help the design of efficient interventions in medicine and in crisis management of financial and biological ecosystems.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.