Pith. sign in

REVIEW 4 major objections 5 minor 76 references

Excitation of Giant Surface Waves During Laser Wake Field Acceleration

T0 review · 4 major / 5 minor · reviewed 2026-08-06 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read A 20 J laser pulse can drive a 35 GV/m terahertz surface wave on a plasma waveguide.

desk verdict Credible evidence for a giant Sommerfeld surface wave in LWFA, but the paper's own numbers give a factor-of-four spread behind the 35 GV/m headline. read the letter →

arxiv 2506.21503 v2 pith:QTMIXDAD submitted 2025-06-26 physics.plasm-ph physics.acc-phphysics.comp-ph

Travis Garrett , Christopher Pieronek , E. Rockafellow , Oliver Sale , Sahir Virani , J. E. Shrock , B. Miao , A. Sloss
show 2 more authors
Jennifer Elle H. M. Milchberg
This is my paper · ORCID
classification physics.plasm-phphysics.acc-phphysics.comp-ph
keywords surfaceplasmonpolaritonSommerfeldwavelaserwakefieldaccelerationplasmawaveguideterahertzgenerationparticle-in-cellsimulationbreakingradio-frequencyemission
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper reports that plasma-waveguided laser wakefield acceleration, in addition to accelerating electrons, also excites a giant cylindrical surface wave on the plasma boundary—a Sommerfeld surface plasmon polariton—that can carry roughly 5% of the drive laser energy as broadband terahertz radiation. The proposed mechanism is that nonlinear wave breaking steadily ejects multi-MeV electrons radially, and this current pulse moves at nearly light speed in step with the surface wave, coherently amplifying it until it saturates. Laboratory measurements of the radial field profile, particle-in-cell simulations, and an analytic saturation formula converge on a 20 J, 65 fs, 800 nm laser pulse producing a 1 J, 400 GW terahertz surface wave with a peak electric field of about 35 GV/m. If this is right, it offers both a new intense THz source and an explanation for the strong radio-frequency bursts that have damaged electronics around such accelerators.

What carries the argument

The load-bearing object is the cylindrical Sommerfeld surface plasmon polariton—a transverse-magnetic surface wave bound to the plasma-vacuum boundary, with Bessel-function fields inside the plasma and Hankel-function (approximately $1/r$, then exponential) fields outside. Its dispersion and outer decay length are computed by iterating the matching condition between the inner Bessel and outer Hankel profiles, and the predicted outer length scale is compared with fits to radial scans with a D-dot probe (a derivative electric-field sensor). The amplifier is the radial current pulse $J_r$ carried by wave-breaking electrons: because the surface wave's phase velocity is nearly $c$, the current stays in step with it and drives it to a saturation set by $E_0 \approx K_{\mathrm{eV},\max}/(r_{\mathrm{pl}} \ln(r_{\max}/r_{\mathrm{pl}}))$, where $K_{\mathrm{eV},\max}$ is the peak kinetic energy of the ejected electrons and $r_{\max}$ their radial excursion.

What would settle it

A direct, independent measurement of the kinetic energy and radial distribution of the ejected MeV electrons (for example, with a radially resolved electron spectrometer) would test the values $K_{\mathrm{eV},\max}=10$ MeV and $r_{\max}\approx 5$ mm that feed the saturation formula; if the measured energies are lower, the 35 GV/m surface-field estimate would collapse.

Watch

Extended reading notes

Core claim

The central claim is that the radial electron current driven by nonlinear wave breaking during plasma-waveguided laser wakefield acceleration excites a high-intensity cylindrical Sommerfeld surface plasmon polariton on the plasma boundary, and that this surface wave co-propagates coherently with the ejecting current until it saturates. The support comes from three independent lines: D-dot probe measurements whose radial decay follows the predicted Hankel-function profile with the expected outer length scale; 3D particle-in-cell simulations showing about 10 MeV electrons ejected from the first wake bubble and a surface field approaching 20 GV/m after 5 ps, with a larger axisymmetric run showing saturation at hundreds of MV/m after 5 cm; and an analytic saturation estimate $E_0 = K_{\mathrm{eV},\max}/(r_{\mathrm{pl}} \ln(r_{\max}/r_{\mathrm{pl}}))$ that gives about 35 GV/m for $K_{\mathrm{eV},\max} = 10$ MeV and $r_{\max} \approx 5$ mm. The paper presents these as converging on a 20 J, 800 nm drive pulse exciting a 1 J, 400 GW broadband THz surface wave with peak field 35 GV/m, about 5% of the laser energy.

Load-bearing premise

The headline field strength of 35 GV/m rests on the simulated values of the ejected electron energy (10 MeV) and their radial expansion scale (about 5 mm), neither of which is independently measured, so errors in either would change the inferred field and THz energy substantially.

Editorial extensions

If this is right

  • A plasma-waveguided laser wakefield accelerator should emit roughly 1 J of broadband THz energy per 20 J drive pulse whenever wave breaking ejects MeV electrons, even when no electron beam is accelerated, because the same RF is observed with and without nitrogen injection.
  • The surface-wave field should saturate at a level set by the most energetic ejected electrons; increasing the drive strength $a_0$ should raise $K_{\mathrm{eV},\max}$ and hence $E_0$, while for $a_0$ below 1 the coherent amplification weakens as wave breaking becomes turbulent.
  • The Hankel-function radial decay measured by a movable D-dot probe provides a direct in-situ diagnostic of the surface-wave field amplitude, plasma radius, and electron density during laser wakefield acceleration.
  • The D-dot calibration simulation, in which a known test wave yields a calculable coax voltage, makes the recorded oscilloscope amplitudes quantitative field measurements in the 1-15 GHz band.
  • The apparent 5% conversion efficiency identifies plasma waveguides as a potential dedicated source of intense broadband terahertz radiation, not just a byproduct of electron acceleration.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The same coherent surface-wave mechanism seen in femtosecond filaments suggests that any cylindrical plasma column driven by an ultrashort high-intensity pulse—capillary-discharge waveguides, hollow-core plasma channels—could radiate a comparable surface-bound THz field; testing this generalization would be a natural next step.
  • If the surface field really saturates at 35 GV/m, electrons in the boundary layer will reach relativistic energy within a skin depth before the wave detaches, which could alter the angular distribution of electrons and x-rays measured outside the plasma, an effect the paper does not discuss.
  • The claim that most of the surface wave detaches at the plasma end suggests a direct end-on measurement of the THz pulse energy with a calibrated energy meter would test the 1 J and 5% efficiency numbers cleanly.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 5 minor

Summary. This paper reports the observation of intense radio-frequency pulses generated during plasma-waveguide laser wakefield acceleration (LWFA) and attributes them to a cylindrical Sommerfeld surface plasmon polariton driven by radially ejected multi-MeV electrons from nonlinear wave breaking. The authors present D-dot probe measurements whose radial falloff is fit to the Hankel-function form of Eq. (1), a dispersion calculation via Eq. (2), 3D and 2D PIC simulations showing a growing surface wave, and an analytic estimate via Eq. (3) giving E0 ≈ 35 GV/m. The paper's central quantitative claim is that laboratory measurements, PIC simulations, and analytic approximations converge on a 20 J drive laser producing a 1 J, 400 GW, 35 GV/m broadband THz surface wave with ~5% conversion efficiency.

Significance. If the 35 GV/m, 1 J, and 5% conversion claims could be substantiated, this would be a significant new LWFA-based THz source and would substantially broaden the importance of the surface-wave mechanism. The paper's qualitative evidence is valuable: the measured radial falloff matching Hankel profiles, the frequency scaling of the fitted outer scale, and the PIC visualization of a radially ejected electron current driving a guided surface wave are all credibly presented. The D-dot calibration simulation and the use of an iterative Sommerfeld dispersion solver are strengths. However, the quantitative headline is not supported by the quoted data, and the asserted three-way convergence is overstated rather than demonstrated.

major comments (4)
  1. [D-dot calibration, final two paragraphs] The claim that measurements, simulations, and Eq. (3) converge on 35 GV/m is not supported by the paper's own numbers. The measured 60 MV/m at r = 10 mm, combined with the paper's 1/r scaling from Eq. (1) with rpl = 70 µm, gives E0 ≈ 60 MV/m × (10 mm / 70 µm) ≈ 8.6 GV/m. The axisymmetric PIC value quoted at the same radius, 145 MV/m, gives E0 ≈ 21 GV/m. Eq. (3) gives 35 GV/m. These three estimates span a factor of roughly 4. If the missing field is intended to come from frequencies above the D-dot's 1–15 GHz band, the measurement cannot validate E0, and the text should state this explicitly and show how the high-frequency contribution is estimated.
  2. [Eq. (3), page 3] The analytic estimate uses KeV,max = 10 MeV and rmax ~ 5 mm taken from the same ICEPIC simulation that also produces the surface wave, so agreement between Eq. (3) and the simulation is not an independent confirmation. There is no independent measurement of the ejected-electron energy or radial excursion. Please present Eq. (3) as a consistency check with the simulation rather than as one leg of a three-way experimental-theoretical convergence.
  3. [Fig. 5 and following paragraph] The quoted '600 MV/m fields extending out to 3 mm' is ambiguous and cannot be compared with E0 = 35 GV/m as written. If the 600 MV/m value is the field at r = 3 mm, the implied surface field under the 1/r form is about 26 GV/m, not 35 GV/m. If it is the peak surface field, it is 0.6 GV/m, more than 50 times below the headline. The manuscript should state what quantity is plotted and how the comparison to Eq. (3) is made.
  4. [Abstract and final paragraph] The '1 J, 400 GW' claim is internally inconsistent with the stated ~1 ps pulse duration: 400 GW × 1 ps = 0.4 J for a flat-top pulse, and less for a Gaussian pulse. If the THz pulse is longer than 1 ps, the duration used for the energy conversion should be specified; if it is ~1 ps, the energy claim should be revised downward by at least a factor of 2.5. In addition, the D-dot measurements cover only 1–15 GHz, so the broadband THz energy and 5% conversion efficiency rest on undetected spectral content, as the paper's own statement that direct THz detection is future work indicates.
minor comments (5)
  1. [Abstract] The word 'enchanced' should be 'enhanced', and the spacing in 'L WF A' should be fixed throughout the paper.
  2. [Reference [63]] The reference title contains a typo: 'mdeia' should be 'media'.
  3. [Page 3, Eq. (2) discussion] The phrase 'initial guess of guess of' contains a duplicated word and should be corrected.
  4. [Plasma parameters] The text uses ne ~ 3 × 10^22 m^-3 when quoting the ~1 THz plasma-frequency cutoff, but the simulations and Fig. 3 use ne = 2 × 10^23 m^-3. Please state the actual experimental/simulation density consistently and explain any variation.
  5. [Fig. 3 caption] The caption should state whether the fits use the full Hankel expression or the 1/r asymptotic form, and should report fit uncertainties and the number of shots averaged per radius.

Circularity Check

1 steps flagged · score 5.0 of 10

The analytic 35 GV/m estimate is partly constructed from the same ICEPIC outputs it claims to agree with.

  1. fitted input called prediction [Analytic estimate following Eq. (3) and the concluding 'converge' paragraph]
    "For instance, KeV,max = 10 MeV electrons that expand out rmax ∼ 5 mm yields E0 ∼ 35 GV/m, in good agreement with the simulations seen in Figs 4 and 5."

    Equation (3) is presented as an independent analytic estimate of the surface field E0, but its inputs KeV,max = 10 MeV and rmax ~ 5 mm are outputs of the same ICEPIC simulation whose SPP field is shown in Figs. 4 and 5. The paper explicitly states that the 10 MeV value comes from that simulation ('with a peak kinetic energy KeV,max of 10 MeV: see Fig. 4'). Using simulation-derived parameters in Eq. (3) and then reporting 'good agreement with the simulations' is therefore a consistency loop rather than an independent prediction. The measured D-dot field at r = 10 mm (60 MV/m) is not converted through the Sommerfeld 1/r scaling to a surface E0 in this comparison, so the claimed three-way convergence is not independently established by the quoted numbers.

full rationale

The paper's central quantitative claim is that laboratory measurements, PIC simulations, and the analytic approximation of Eq. (3) converge on E0 ~ 35 GV/m. The analytic leg of that convergence is partially circular: Eq. (3) uses KeV,max and rmax taken from the same ICEPIC simulation that also produces the simulated surface wave, so the agreement between Eq. (3) and Figs. 4-5 is partly built in. However, other important elements are independent of that loop. The measured radial Hankel-profile fits and the Sommerfeld dispersion calculation of Eq. (2) are compared against independent D-dot data, and the D-dot calibration simulation is a separate conformal ICEPIC run used only to convert recorded voltages to fields. The paper's self-citations to prior filamentation work are motivational and methodological, not load-bearing proof of the LWFA surface wave. Thus the circularity is real but partial: one leg of the convergence reduces to simulation inputs, while the measurement and dispersion fits retain independent content. The quantitative consistency of the three legs is weaker than claimed, because the measured 60 MV/m at r = 10 mm does not trivially yield 35 GV/m at the surface under the paper's own radial scaling, but that is a correctness concern rather than an additional circularity. Overall score 5 reflects a partially constructed convergence rather than a fully self-referential derivation.

Assumptions & free parameters 5 free parameters · 5 assumptions · 0 invented entities

The paper introduces no new physical entities; it applies known Sommerfeld surface wave theory and plasma permittivity models. The main free parameters are the plasma radius, density, and the ejected electron energy and excursion used in Eq. (3), none of which are independently measured in the same shot as the RF detection.

free parameters (5)
  • rpl = 70 um
    Plasma column radius used in Sommerfeld theory fits, taken from hydrodynamic simulations, not measured shot-to-shot.
  • ne = 2 x 10^23 m^-3
    Electron density used in theory, taken from waveguide hydrodynamic model.
  • KeV,max = 10 MeV
    Peak ejected electron kinetic energy from PIC simulation, used in Eq. (3) to compute E0.
  • rmax = 5 mm
    Assumed maximum radial excursion of expelled electrons, used in Eq. (3); no independent measurement.
  • collision frequency nu = 0
    Assumption of negligible electron collision frequency in plasma permittivity model.
assumptions (5)
  • standard math Sommerfeld surface wave solution with Bessel/Hankel profiles for cylindrical plasma boundary
    Used in Eq. (1) and Eq. (2), standard solution of Maxwell equations with boundary conditions.
  • domain assumption Plasma permittivity model epsilon_pl(omega) = 1 + omega_pl^2 / (i omega nu - omega^2)
    Invoked in Eq. (2); collisionless limit assumed.
  • domain assumption Nonlinear wave breaking ejects a continuous stream of multi-MeV electrons radially from the plasma
    Supported by PIC simulations in this paper, but not independently measured.
  • domain assumption The radial current Jr from ejected electrons excites and coherently drives the surface wave
    Transferred from femtosecond filamentation analogy (refs [20-23]); assumed to hold in LWFA.
  • standard math Iterative solution of Eq. (2) converges to the correct dispersion relation
    Standard numerical root-finding, not original.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Excitation of Giant Surface Waves During Laser Wake Field Acceleration." pith.science (2026). https://pith.science/paper/QTMIXDAD

@misc{pith2026250621503,
  author       = {Pith},
  title        = {Pith review of: Excitation of Giant Surface Waves During Laser Wake Field Acceleration},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/QTMIXDAD}},
  note         = {Machine review of arXiv:2506.21503}
}
read the original abstract

We have detected the presence of very high intensity surface waves that are excited during plasma waveguided laser wakefield acceleration. Wakefield acceleration can be enchanced by the introduction of an ``all optical" plasma waveguide that confines and guides a laser pulse at the optimal intensity over long distances, producing quasimonoenergetic multi-GeV electron bunches. However strong pulses of radio frequency radiation (RF) are also produced, and particle in cell simulations show why: a continuous stream of multi-MeV electrons are also ejected radially from the plasma due to nonlinear wave breaking, and these excite and copropagate coherently with a giant cylindrical Sommerfeld surface wave. Laboratory measurements, simulations, and analytic approximations all converge on a 20 J laser pulse exciting a 1 Joule, 400 GW broadband THz surface wave, with a peak electric field strength of 35 GV/m.

Figures

Figures reproduced from arXiv: 2506.21503 by the authors.

Figure 1
Figure 1. FIG. 1. (a) Down axis view of the gas jet in the LWFA [PITH_FULL_IMAGE:figures/full_fig_p002_1.png] view at source ↗
Figure 2
Figure 2. FIG. 2. Average FFTs as a function of D-dot separation [PITH_FULL_IMAGE:figures/full_fig_p003_2.png] view at source ↗
Figure 4
Figure 4. FIG. 4. (a) 2D slice of electron [PITH_FULL_IMAGE:figures/full_fig_p004_4.png] view at source ↗
Figures from the paper (1 more)
Figure 5
Figure 5. Figure 5: FIG. 5. (a) Log plot of [PITH_FULL_IMAGE:figures/full_fig_p005_5.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

76 extracted references · 75 canonical work pages

  1. [1]

    Compression of amplified chirped optical pulses,

    Donna Strickland and Gerard Mourou, “Compression of amplified chirped optical pulses,” Optics communications 56, 219–221 (1985)

    work page 1985

  2. [2]

    Generation of ultrahigh peak power pulses by chirped pulse amplification,

    P Maine, D Strickland, P Bado, M Pessot, and G Mourou, “Generation of ultrahigh peak power pulses by chirped pulse amplification,” IEEE Journal of Quan- tum electronics 24, 398–403 (1988)

    work page 1988

  3. [3]

    0.5-tw, 125-fs ti: sapphire laser,

    JD Kmetec, JJ Macklin, and JF Young, “0.5-tw, 125-fs ti: sapphire laser,” Optics letters 16, 1001–1003 (1991)

    work page 1991

  4. [4]

    Terawatt to petawatt subpicosecond lasers,

    Michael D Perry and Gerard Mourou, “Terawatt to petawatt subpicosecond lasers,” Science 264, 917–924 (1994)

    work page 1994

  5. [5]

    Attosecond metrology,

    Michael Hentschel, Reinhard Kienberger, Ch Spielmann, Georg A Reider, Nenad Milosevic, Thomas Brabec, Paul Corkum, Ulrich Heinzmann, Markus Drescher, and Fer- enc Krausz, “Attosecond metrology,” Nature 414, 509– 513 (2001)

    work page 2001

  6. [6]

    Attosecond physics,

    Ferenc Krausz and Misha Ivanov, “Attosecond physics,” Reviews of modern physics 81, 163–234 (2009)

    work page 2009

  7. [7]

    Laser ablation and mi- cromachining with ultrashort laser pulses,

    X Liu, D Du, and G Mourou, “Laser ablation and mi- cromachining with ultrashort laser pulses,” IEEE journal 6 of quantum electronics 33, 1706–1716 (1997)

    work page 1997

  8. [8]

    Walter Sekundo, Kathleen S Kunert, and Marcus Blum, “Small incision corneal refractive surgery using the small incision lenticule extraction (smile) procedure for the cor- rection of myopia and myopic astigmatism: results of a 6 month prospective study,” British Journal of Ophthal- mology 95, 335–339 (2011)

    work page 2011

Show all 76 references
  1. [9]

    Ion acceleration by superintense laser-plasma interac- tion,

    Andrea Macchi, Marco Borghesi, and Matteo Passoni, “Ion acceleration by superintense laser-plasma interac- tion,” Reviews of Modern Physics 85, 751–793 (2013)

    2013

  2. [10]

    Extremely high-intensity laser interactions with fundamental quantum systems,

    A Di Piazza, C M¨ uller, KZ Hatsagortsyan, and Ch H Keitel, “Extremely high-intensity laser interactions with fundamental quantum systems,” Reviews of Modern Physics 84, 1177 (2012)

    2012

  3. [11]

    Advances in qed with intense background fields,

    A Fedotov, A Ilderton, F Karbstein, Ben King, D Seipt, H Taya, and Greger Torgrimsson, “Advances in qed with intense background fields,” Physics Reports 1010, 1–138 (2023)

    2023

  4. [12]

    Physics of laser-driven plasma-based electron accelera- tors,

    Eric Esarey, Carl B Schroeder, and Wim P Leemans, “Physics of laser-driven plasma-based electron accelera- tors,” Reviews of modern physics 81, 1229–1285 (2009)

    2009

  5. [13]

    Self-channeling of high-peak-power femtosecond laser pulses in air,

    A Braun, G Korn, X Liu, D Du, J Squier, and G Mourou, “Self-channeling of high-peak-power femtosecond laser pulses in air,” Optics letters 20, 73–75 (1995)

    1995

  6. [14]

    Femtosec- ond filamentation in transparent media,

    Arnaud Couairon and Andr´ e Mysyrowicz, “Femtosec- ond filamentation in transparent media,” Physics reports 441, 47–189 (2007)

    2007

  7. [15]

    The 2023 terahertz science and technology roadmap,

    Alfred Leitenstorfer, Andrey S Moskalenko, Tobias Kampfrath, Junichiro Kono, Enrique Castro-Camus, Kun Peng, Naser Qureshi, Dmitry Turchinovich, Koichiro Tanaka, Andrea G Markelz, et al. , “The 2023 terahertz science and technology roadmap,” Journal of Physics D: Applied Physi...

    2023

  8. [16]

    Half-cycle terahertz surface waves with mv/cm field strengths generated on metal wires,

    Kensuke Teramoto, Shigeki Tokita, Tokinori Terao, Shunsuke Inoue, Ryo Yasuhara, Takeshi Nagashima, Sadaoki Kojima, Junji Kawanaka, Kazuaki Mori, Masaki Hashida, et al. , “Half-cycle terahertz surface waves with mv/cm field strengths generated on metal wires,” Ap- plied Physics...

    2018

  9. [17]

    Efficiently laser driven terahertz surface plasmon polaritons on long metal wire,

    Shuoting Shao, Xiangbing Wang, Rong Huang, Guangyue Hu, Min Chen, Huibo Tang, Longyu Kuang, Yuxi Liu, Yuqiu Gu, Yongkun Ding, et al. , “Efficiently laser driven terahertz surface plasmon polaritons on long metal wire,” arXiv preprint arXiv:2502.08048 (2025)

    2025 arXiv

  10. [18]

    Interaction of ultra- high laser fields with beams and plasmas,

    Phillip Sprangle and Eric Esarey, “Interaction of ultra- high laser fields with beams and plasmas,” Physics of Fluids B: Plasma Physics 4, 2241–2248 (1992)

    1992

  11. [19]

    Light pipe for high intensity laser pulses,

    CG Durfee III and HM Milchberg, “Light pipe for high intensity laser pulses,” Physical review letters 71, 2409 (1993)

    1993

  12. [20]

    Measurement and control of plasma oscillations in fem- tosecond filaments,

    Bing Zhou, Aur´ elien Houard, Yi Liu, Bernard Prade, Andr´ e Mysyrowicz, Arnaud Couairon, Patrick Mora, Christopher Smeenk, Ladan Arissian, and Paul Corkum, “Measurement and control of plasma oscillations in fem- tosecond filaments,” Physical review letters 106, 255002 (2011)

    2011

  13. [21]

    Gas pressure dependence of microwave pulses gen- erated by laser-produced filament plasmas,

    Alexander Englesbe, Jennifer Elle, Remington Reid, Adrian Lucero, Hugh Pohle, Matthew Domonkos, Serge Kalmykov, Karl Krushelnick, and Andreas Schmitt- Sody, “Gas pressure dependence of microwave pulses gen- erated by laser-produced filament plasmas,” Optics Let- ters 43, 4953–...

    2018

  14. [22]

    Generation of radio frequency radiation by femtosecond filaments,

    Travis Garrett, Jennifer Elle, Michael White, Remington Reid, Alexander Englesbe, Ryan Phillips, Peter Mardahl, Erin Thornton, James Wymer, Anna Janicek, et al. , “Generation of radio frequency radiation by femtosecond filaments,” Physical Review E 104, L063201 (2021)

    2021

  15. [23]

    Detection of surface waves during fem- tosecond filamentation,

    Travis Garrett, Anna Janicek, J Todd Fayard II, and Jennifer Elle, “Detection of surface waves during fem- tosecond filamentation,” Physical Review E 111, 045206 (2025)

    2025

  16. [24]

    Plasma losses by fast electrons in thin films,

    Rufus H Ritchie, “Plasma losses by fast electrons in thin films,” Physical review 106, 874 (1957)

    1957

  17. [25]

    Theory of surface plasmons and surface-plasmon polaritons,

    JM Pitarke, VM Silkin, EV Chulkov, and PM Echenique, “Theory of surface plasmons and surface-plasmon polaritons,” Reports on progress in physics 70, 1 (2006)

    2006

  18. [26]

    all optical

    is that plasmas can support very large accelerating fields ( |E| ∼100 GV/m), some 10 3 times greater than in traditional LINACs. In the simplest setup for L WF A, a sufficiently energetic short pulse laser is focused into a short gas jet and undergoes relativistic self-focusin...

    2025 arXiv

  19. [27]

    Laser electron ac- celerator,

    Toshiki Tajima and John M Dawson, “Laser electron ac- celerator,” Physical review letters 43, 267 (1979)

    1979

  20. [28]

    Guiding of high intensity laser pulses in straight and curved plasma channel experiments,

    Y Ehrlich, C Cohen, A Zigler, J Krall, P Sprangle, and E Esarey, “Guiding of high intensity laser pulses in straight and curved plasma channel experiments,” Phys- ical review letters 77, 4186 (1996)

    1996

  21. [29]

    Guiding of high-intensity laser pulses with a hydrogen- filled capillary discharge waveguide,

    Arthur Butler, DJ Spence, and Simon Mark Hooker, “Guiding of high-intensity laser pulses with a hydrogen- filled capillary discharge waveguide,” Physical Review Letters 89, 185003 (2002)

    2002

  22. [30]

    Multi-gev electron beams from capillary-discharge-guided subpetawatt laser pulses in the self-trapping regime,

    WP Leemans, AJ Gonsalves, H-S Mao, K Nakamura, C Benedetti, CB Schroeder, Cs T´ oth, J Daniels, DE Mit- telberger, SS Bulanov, et al. , “Multi-gev electron beams from capillary-discharge-guided subpetawatt laser pulses in the self-trapping regime,” Physical review letters 113,...

    2014

  23. [31]

    Optical guiding in meter- scale plasma waveguides,

    Bo Miao, Linus Feder, JE Shrock, Andrew Gof- fin, and HM Milchberg, “Optical guiding in meter- scale plasma waveguides,” Physical Review Letters 125, 074801 (2020)

    2020

  24. [32]

    Self-waveguiding of relativistic laser pulses in neu- tral gas channels,

    L Feder, B Miao, JE Shrock, A Goffin, and HM Milch- berg, “Self-waveguiding of relativistic laser pulses in neu- tral gas channels,” Physical Review Research 2, 043173 (2020)

    2020

  25. [33]

    Multi-gev electron bunches from an all-optical laser wakefield accelerator,

    B Miao, JE Shrock, L Feder, RC Hollinger, J Morrison, R Nedbailo, A Picksley, H Song, S Wang, JJ Rocca,et al., “Multi-gev electron bunches from an all-optical laser wakefield accelerator,” Physical Review X 12, 031038 (2022)

    2022

  26. [34]

    Laser-driven acceler- ation of electrons in a partially ionized plasma channel,

    TP Rowlands-Rees, C Kamperidis, S Kneip, AJ Gon- salves, SPD Mangles, JG Gallacher, E Brunetti, T Ibbot- son, CD Murphy, PS Foster,et al., “Laser-driven acceler- ation of electrons in a partially ionized plasma channel,” Physical Review Letters 100, 105005 (2008)

    2008

  27. [35]

    Injection and trapping of tunnel-ionized electrons into laser-produced wakes,

    Arthur Pak, KA Marsh, SF Martins, W Lu, WB Mori, and C Joshi, “Injection and trapping of tunnel-ionized electrons into laser-produced wakes,” Physical review let- ters 104, 025003 (2010)

    2010

  28. [36]

    Ionization in- duced trapping in a laser wakefield accelerator,

    C McGuffey, AGR Thomas, W Schumaker, T Matsuoka, V Chvykov, FJ Dollar, G Kalintchenko, V Yanovsky, A Maksimchuk, K Krushelnick, et al. , “Ionization in- duced trapping in a laser wakefield accelerator,” Physical review letters 104, 025004 (2010)

    2010

  29. [37]

    Guided mode evolution and ionization injection in meter-scale multi-gev laser wakefield acceler- ators,

    JE Shrock, E Rockafellow, B Miao, M Le, RC Hollinger, S Wang, AJ Gonsalves, A Picksley, JJ Rocca, and HM Milchberg, “Guided mode evolution and ionization injection in meter-scale multi-gev laser wakefield acceler- ators,” Physical Review Letters 133, 045002 (2024)

    2024

  30. [38]

    Matched guiding and controlled 7 injection in dark-current-free, 10-gev-class, channel- guided laser-plasma accelerators,

    A Picksley, J Stackhouse, C Benedetti, K Nakamura, HE Tsai, R Li, B Miao, JE Shrock, E Rockafellow, HM Milchberg, et al. , “Matched guiding and controlled 7 injection in dark-current-free, 10-gev-class, channel- guided laser-plasma accelerators,” Physical Review Let- ters 133,...

    2024

  31. [39]

    Development of a high charge 10 gev laser electron accelerator,

    E Rockafellow, B Miao, JE Shrock, A Sloss, MS Le, SW Hancock, S Zahedpour, RC Hollinger, S Wang, J King, et al. , “Development of a high charge 10 gev laser electron accelerator,” Physics of Plasmas32, 053102 (2025)

    2025

  32. [40]

    Observation of tera- hertz emission from a laser-plasma accelerated electron bunch crossing a plasma-vacuum boundary,

    WP Leemans, CGR Geddes, J Faure, Cs T´ oth, J Van Tilborg, CB Schroeder, E Esarey, G Fubiani, D Auerbach, B Marcelis, et al. , “Observation of tera- hertz emission from a laser-plasma accelerated electron bunch crossing a plasma-vacuum boundary,” Physical re- view letters 91, ...

    2003

  33. [41]

    Terahertz pulse generation in underdense rela- tivistic plasmas: From photoionization-induced radiation to coherent transition radiation,

    J D´ echard, A Debayle, X Davoine, L Gremillet, and L Berg´ e, “Terahertz pulse generation in underdense rela- tivistic plasmas: From photoionization-induced radiation to coherent transition radiation,” Physical Review Let- ters 120, 144801 (2018)

    2018

  34. [42]

    Thz gener- ation from relativistic plasmas driven by near-to far- infrared laser pulses,

    J D´ echard, X Davoine, and L Berg´ e, “Thz gener- ation from relativistic plasmas driven by near-to far- infrared laser pulses,” Physical Review Letters 123, 264801 (2019)

    2019

  35. [43]

    0.85 pw laser oper- ation at 3.3 hz and high-contrast ultrahigh-intensity λ= 400 nm second-harmonic beamline,

    Yong Wang, Shoujun Wang, Alex Rockwood, Bradley M Luther, Reed Hollinger, Alden Curtis, Chase Calvi, Car- men S Menoni, and Jorge J Rocca, “0.85 pw laser oper- ation at 3.3 hz and high-contrast ultrahigh-intensity λ= 400 nm second-harmonic beamline,” Optics letters 42, 3828–38...

    2017

  36. [44]

    Length dependence on broadband microwave emission from laser-generated plasmas,

    A Janicek, E Thornton, T Garrett, A Englesbe, J Elle, and A Schmitt-Sody, “Length dependence on broadband microwave emission from laser-generated plasmas,” IEEE Transactions on Plasma Science 48, 1979–1983 (2020)

    2020

  37. [45]

    Coherently enhanced microwave pulses from midinfrared-driven laser plasmas,

    A V Mitrofanov, DA Sidorov-Biryukov, MM Nazarov, AA Voronin, MV Rozhko, AB Fedotov, and AM Zheltikov, “Coherently enhanced microwave pulses from midinfrared-driven laser plasmas,” Optics Letters 46, 1081–1084 (2021)

    2021

  38. [46]

    Ultrabroadband microwave radiation from near-and mid-infrared laser-produced plasmas in air,

    Alexander Englesbe, Jennifer Elle, Robert Schwartz, Travis Garrett, Daniel Woodbury, Dogeun Jang, Ki- Yong Kim, Howard Milchberg, Remington Reid, Adrian Lucero, et al. , “Ultrabroadband microwave radiation from near-and mid-infrared laser-produced plasmas in air,” Physical Rev...

    2021

  39. [47]

    Boosting radio frequency radiation with collisional pro- cesses in picosecond laser filamentation,

    Erin Thornton, Travis Garrett, and Jennifer Elle, “Boosting radio frequency radiation with collisional pro- cesses in picosecond laser filamentation,” Physics of Plas- mas 31 (2024)

    2024

  40. [48]

    Charles K Birdsall and A Bruce Langdon, Plasma physics via computer simulation (CRC press, 2004)

    2004

  41. [49]

    Roger W Hockney and James W Eastwood, Computer simulation using particles (crc Press, 2021)

    2021

  42. [50]

    Ueber die fortpflanzung elektro- dynamischer wellen l¨ angs eines drahtes,

    Arnold Sommerfeld, “Ueber die fortpflanzung elektro- dynamischer wellen l¨ angs eines drahtes,” Annalen der Physik 303, 233–290 (1899)

  43. [51]

    Surface waves and their application to transmission lines,

    Georg Goubau, “Surface waves and their application to transmission lines,” Journal of Applied Physics21, 1119– 1128 (1950)

    1950

  44. [52]

    33 (John Wiley & Sons, 2007)

    Julius Adams Stratton, Electromagnetic theory, Vol. 33 (John Wiley & Sons, 2007)

    2007

  45. [53]

    Electromagnetic waves and an- tennas,

    Sophocles J Orfanidis, “Electromagnetic waves and an- tennas,” (2002)

    2002

  46. [54]

    Surface po- laritons in a circularly cylindrical interface: surface plas- mons,

    CA Pfeiffer, EN Economou, and KL Ngai, “Surface po- laritons in a circularly cylindrical interface: surface plas- mons,” Physical review B 10, 3038 (1974)

    1974

  47. [55]

    Dispersion of surface plasmon polaritons on metal wires in the ter- ahertz frequency range,

    Kanglin Wang and Daniel M Mittleman, “Dispersion of surface plasmon polaritons on metal wires in the ter- ahertz frequency range,” Physical Review Letters 96, 157401 (2006)

    2006

  48. [56]

    Single-cycle surface plasmon polaritons on a bare metal wire excited by relativistic electrons,

    WPEM Op ‘t Root, GJH Brussaard, PW Smorenburg, and OJ Luiten, “Single-cycle surface plasmon polaritons on a bare metal wire excited by relativistic electrons,” Nature Communications 7, 13769 (2016)

    2016

  49. [57]

    Electron beam excitation of surface plasmon polaritons,

    Sen Gong, Min Hu, Renbin Zhong, Xiaoxing Chen, Ping Zhang, Tao Zhao, and Shenggang Liu, “Electron beam excitation of surface plasmon polaritons,” Optics express 22, 19252–19261 (2014)

    2014

  50. [58]

    Radiation from surface-wave antennas,

    JB Andersen, “Radiation from surface-wave antennas,” Electronics Letters 3, 251–252 (1967)

    1967

  51. [59]

    Towards high- repetition-rate intense terahertz source with metal wire- based plasma,

    Dongdong Zhang, Yafeng Bai, Yushan Zeng, Yingying Ding, Zhongpeng Li, Chuliang Zhou, Yuxin Leng, Li- wei Song, Ye Tian, and Ruxin Li, “Towards high- repetition-rate intense terahertz source with metal wire- based plasma,” IEEE Photonics Journal 14, 1–5 (2022)

    2022

  52. [60]

    Excita- tion of surface polaritons by end-fire coupling,

    GI Stegeman, RF Wallis, and AA Maradudin, “Excita- tion of surface polaritons by end-fire coupling,” Optics letters 8, 386–388 (1983)

    1983

  53. [61]

    Electron self- interjection into an evolving plasma bubble: Quasi- monoenergetic laser-plasma acceleration in the blowout regime,

    Serguei Y Kalmykov, Arnaud Beck, SA Yi, Vladimir N Khudik, Michael C Downer, E Lefebvre, Bradley Al- lan Shadwick, and DP Umstadter, “Electron self- interjection into an evolving plasma bubble: Quasi- monoenergetic laser-plasma acceleration in the blowout regime,” Physics of P...

    2011

  54. [62]

    Benjamin R Galloway, Patrick K Rambo, Matthias Geis- sel, Mark W Kimmel, Jeffrey W Kellogg, Jennifer Elle, Travis Garrett, John L Porter, and Gregory A Rochau,A study of sacrificial mirrors for use prior to a laser wake- field accelerator driven by the Z-Petawatt laser , Tech....

    2022

  55. [63]

    Electromagnetic surface wave propagation in a metallic wire and the lambert w func- tion,

    J Ricardo G Mendon¸ ca, “Electromagnetic surface wave propagation in a metallic wire and the lambert w func- tion,” American Journal of Physics 87, 476–484 (2019)

    2019

  56. [64]

    Numerical solution of initial boundary value problems involving maxwell’s equations in isotropic mdeia,

    Kane Yee, “Numerical solution of initial boundary value problems involving maxwell’s equations in isotropic mdeia,” IEEE Transactions on antennas and propagation 14, 302–307 (1966)

    1966

  57. [65]

    Rigorous charge conservation for local electromagnetic field solvers,

    John Villasenor and Oscar Buneman, “Rigorous charge conservation for local electromagnetic field solvers,” Computer Physics Communications 69, 306–316 (1992)

    1992

  58. [66]

    Relativistic plasma simulation- optimization of a hybrid code,

    Jay P Boris, “Relativistic plasma simulation- optimization of a hybrid code,” in Proc. Fourth Conf. Num. Sim. Plasmas (1970) pp. 3–67

    1970

  59. [67]

    A virtual prototyping environment for directed-energy concepts,

    Robert E Peterkin and John W Luginsland, “A virtual prototyping environment for directed-energy concepts,” Computing in Science & Engineering 4, 42–49 (2002)

    2002

  60. [68]

    Benchmarking of hydrodynamic plasma waveguides for multi-gev laser- driven electron acceleration,

    Bo Miao, Ela Rockafellow, JE Shrock, SW Hancock, Daniel Gordon, and HM Milchberg, “Benchmarking of hydrodynamic plasma waveguides for multi-gev laser- driven electron acceleration,” Physical Review Acceler- ators and Beams 27, 081302 (2024)

    2024

  61. [69]

    Nonlinear electron oscillations in a cold plasma,

    John M Dawson, “Nonlinear electron oscillations in a cold plasma,” Physical review 113, 383 (1959)

    1959

  62. [70]

    Transverse-wake wave breaking,

    SV Bulanov, Francesco Pegoraro, AM Pukhov, and AS Sakharov, “Transverse-wake wave breaking,” Phys- ical review letters 78, 4205 (1997)

    1997

  63. [71]

    On imple- menting a numeric huygen’s source scheme in a finite dif- 8 ference program to illuminate scattering bodies,

    DE Merewether, R Fisher, and FW Smith, “On imple- menting a numeric huygen’s source scheme in a finite dif- 8 ference program to illuminate scattering bodies,” IEEE Transactions on Nuclear Science 27, 1829–1833 (1980)

    1980

  64. [72]

    Allen Taflove and Susan C Hagness, Computational elec- trodynamics: the finite-difference time-domain method (Artech house, 2005)

    2005

  65. [73]

    A uniformly stable conformal fdtd-method in cartesian grids,

    IA Zagorodnov, Rolf Schuhmann, and Thomas Weiland, “A uniformly stable conformal fdtd-method in cartesian grids,” International Journal of Numerical Modelling: Electronic Networks, Devices and Fields 16, 127–141 (2003)

    2003

  66. [74]

    A 3-d enlarged cell tech- nique (ect) for the conformal fdtd method,

    Tian Xiao and Qing Huo Liu, “A 3-d enlarged cell tech- nique (ect) for the conformal fdtd method,” IEEE trans- actions on antennas and propagation 56, 765–773 (2008)

    2008

  67. [75]

    Implementation of collocated surface impedance boundary conditions in fdtd,

    Gregory Kobidze, “Implementation of collocated surface impedance boundary conditions in fdtd,” IEEE transac- tions on antennas and propagation 58, 2394–2403 (2010)

    2010

  68. [76]

    A perfectly matched layer for the absorption of electromagnetic waves,

    Jean-Pierre Berenger, “A perfectly matched layer for the absorption of electromagnetic waves,” Journal of compu- tational physics 114, 185–200 (1994)

    1994

Pith tools

Reviewed August 6, 2026 · model on record in the stance chip above.