Pith. sign in

REVIEW 2 major objections 3 minor 31 references

Goldstone mode of the broken helix in U(1) magnet EuIn2As2

T0 review · 2 major / 3 minor · reviewed 2026-08-10 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read Broken-helix spin mode in EuIn2As2 scales linearly with applied magnetic field.

desk verdict A genuinely interesting experimental and symmetry-based result whose central theoretical step—a nonzero H^2 coefficient for the broken helix—is asserted rather than shown; worth refereeing, but the theory needs to close that gap. read the letter →

arxiv 2501.09084 v1 pith:R2J3SEYY submitted 2025-01-15 cond-mat.mtrl-sci

Alex Liebman-Pelaez , Samuel J. Garratt , Veronika Sunko , Yue Sun , Jian R. Soh , Dharmalingam Prabhakaran , Andrew T. Boothroyd , Joseph Orenstein This is my paper · ORCID
classification cond-mat.mtrl-sci
keywords GoldstonemodebrokenhelixEuIn2As2time-resolvedopticalpolarimetryspin-wavedynamicsmagneticsymmetryin-planefieldnematicorder
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper reports that the Goldstone mode of the broken helix in EuIn2As2, an interpenetrating antiferromagnetic and six-fold helical spin structure, has a frequency that scales linearly with an in-plane magnetic field from just above the spin-flop transition up to saturation. The authors show by a symmetry argument that this linear scaling is the lowest order allowed for any magnetic ground state with the same $C_{2z}$ rotational symmetry, which is why the broken helix behaves like a simple antiferromagnet rather than like a conventional helix. They also demonstrate, with a time-resolved optical polarimetry technique that separates longitudinal from transverse nematic dynamics and from magneto-optical Kerr rotation, that the mode is a near-uniform spin precession only when the field dominates over strain. If the claim holds, the field-scaling exponent of a Goldstone mode becomes a direct probe of the symmetry of a magnetic ground state, even for complex multi-Q magnets.

What carries the argument

The central object is the $2N\times 2N$ dynamical matrix $D(H)$ of zero-wavevector linearized spin dynamics, whose eigenvalues occur in opposite-signed pairs $\pm f_\nu$; the Goldstone mode is the pair with $f_G(0)=0$ in zero field. The core identity is the symmetry constraint $p(f,H)=p(f,RH)$ on the characteristic polynomial $p(f,H)=\det(fI-D(H))$ for every rotation $R$ in the point group of the zero-field ground state. For the $C_{2z}$-symmetric broken helix this forces only terms with $u+v$ even in the expansion $f_G^2(H)-f_G^2(0)\sim\sum_{uv}c_{uv}H^{u+v}(\cos\varphi)^u(\sin\varphi)^v$, so the lowest nonzero contribution is $O(H^2)$. The machinery also includes a variational upper bound $\lambda_0(H)\le \frac{H^2}{2N}\big(s^T\rho^{-1}s-c^T\rho^{-1}c\big)$ on the smallest Hessian eigenvalue, which shows why the linear term survives for the broken helix and why it cancels for a symmetric $N$-spin helix, where $|v_n\cdot s|^2=|v_n\cdot c|^2$. On the experimental side, the load-bearing setup is the polarimetric decomposition of the reflected probe into a birefringence signal $\delta\eta$, with longitudinal and transverse nematic components $\delta\eta_\parallel$ and $\delta\eta_\perp$, and a MOKE signal $\delta\xi$, which together determine both the frequency and the eigenvector character of the mode.

What would settle it

Take the measured zero-field broken-helix configuration of EuIn2As2, compute the Hessian $\rho$ of the classical spin Hamiltonian, form the vectors $s_j=\sin\theta_j^{(0)}$ and $c_j=\cos\theta_j^{(0)}$, and evaluate $s^T\rho^{-1}s-c^T\rho^{-1}c$; if it is zero, the predicted scaling is $f_G\sim H^2$ rather than $f_G\sim H$. A purely experimental check would be high-resolution measurement of $f_G$ at fields from roughly 0.1 T down to 0.01 T to distinguish a linear from a quadratic exponent.

Watch

Extended reading notes

Core claim

On its own terms, the paper's central claim is that the lowest-frequency magnetic excitation of the broken helix in EuIn2As2, measured at zero wavevector by time-resolved optical polarimetry, obeys $f_G \sim H_\parallel$ over the field range where the field dominates strain, including across the helix-to-fan transition at $H_{\mathrm{hf}}\approx 0.63$ T and up to saturation at $H_{\mathrm{sat}}\approx 1.46$ T. The reason, the paper argues, is symmetry: the characteristic polynomial of the spin-wave dynamical matrix must be invariant under the $\pi$ rotation $C_{2z}$ of the ground state, which restricts the expansion of $f_G^2(H)$ to terms of even total order in the field components, so the lowest allowed correction is $O(H^2)$, giving $f_G\sim H$. A complementary microscopic calculation identifies the condition for the $O(H^2)$ coefficient to be nonzero: the quantity $s^T\rho^{-1}s - c^T\rho^{-1}c$, built from the zero-field Hessian and the vectors $s_j=\sin\theta_j^{(0)}$, $c_j=\cos\theta_j^{(0)}$, must not vanish, which the paper states is generically true for the broken helix but not for a symmetric helix. This places the broken helix and the collinear antiferromagnet in the same universality class for Goldstone-mode field scaling, despite their very different spin textures.

Load-bearing premise

The argument assumes that a certain energy-cost combination, built from the zero-field spin structure, is nonzero in the actual broken-helix state; if that combination vanished, the linear scaling would fail and the frequency would grow as a higher power of the field.

Editorial extensions

If this is right

  • Any zero-net-moment magnetic ground state whose point group contains $C_{2z}$ should show $f_G\propto H_\parallel$ at low field, even if its magnetic unit cell is large and multi-Q.
  • Conventional $N$-spin helices are predicted to show $f_G\propto H_\parallel^{N/2}$, a scaling the paper confirms numerically for Heisenberg and RKKY-type models, with the $N\to\infty$ sine-Gordon limit giving an infinitely soft mode.
  • Across the helix-to-fan transition at $H_{\mathrm{hf}}\approx 0.63$ T the linear-in-field scaling persists, meaning the mode exponent is controlled by ground-state symmetry rather than by the detailed spin re-arrangement.
  • The strain-to-field crossover changes the Goldstone-mode eigenvector from an intra-unit-cell longitudinal nematic motion to a near-uniform transverse precession, so the same measurement that gives the frequency also identifies which symmetry-breaking perturbation dominates.
  • The polarimetry technique can map spin-wave frequency, damping, and eigenvector structure with roughly $5\,\mu$m spatial resolution, allowing strain-orientation dependence to be studied continuously across a single crystal.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Editorial extension: if $C_{2z}$ symmetry is indeed the controlling condition, then breaking that symmetry, for example by tilting the field slightly out of the plane or applying a uniaxial strain whose easy axis is rotated relative to the nematic director, should restore a different scaling exponent, which could be checked in the same sample.
  • Editorial extension: the same symmetry-polynomial argument should apply to other pseudo-Goldstone modes in $C_{2z}$-symmetric magnets, such as the broken-fan states reported in the same material, giving a way to identify their symmetry class from field-scaling measurements alone.
  • Editorial extension: because the linear scaling survives the helix-to-fan transition, the exponent may be robust to temperature as well, up to the ordering temperature; measuring $f_G(H,T)$ just below $T_{N2}$ could test whether the symmetry classification remains valid when fluctuations are stronger.
  • Editorial extension: the numerical demonstration that $\alpha(N)=N/2$ for helices across different interaction ranges suggests the same scaling should hold for incommensurate helices if treated as the $N\to\infty$ limit, where the mode becomes asymptotically soft; an inelastic neutron experiment on a long-period helix could test the divergence.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

2 major / 3 minor

Summary. The paper reports time-resolved optical polarimetry measurements on the broken-helix phase of EuIn2As2, showing that the lowest-frequency spin-wave mode exhibits near-uniform precession and a frequency that scales linearly with an in-plane magnetic field from just above the spin-flop transition up to the saturation field. The authors propose a symmetry-based argument: for a C2z-symmetric magnet with a U(1) Goldstone mode, f_G^2 is constrained to be an even function of H, so f_G ∝ H is the lowest allowed order. They contrast this with conventional single-Q helices, where f_G ∝ H^{N/2}, and support that scaling numerically for several helical models. A microscopic analysis in the Supplemental Material is invoked to argue that the H^2 coefficient is generically nonzero for the broken helix, which is the step that distinguishes it from the conventional helix.

Significance. If the conclusions hold, the paper provides a clear experimental demonstration of how magnetic point-group symmetry controls the field scaling of a Goldstone mode in a multi-Q magnet, and the symmetry framework is elegant and potentially general. The experiment itself—spatially resolved optical polarimetry that separates nematic and MOKE channels—is a strong technical contribution, and the numerical confirmation of the H^{N/2} scaling for helices is a useful reference result. However, the microscopic proof that the leading coefficient is nonzero for the broken helix is currently incomplete, which weakens the theoretical explanation of the central observation.

major comments (2)
  1. [Supplemental Material, Sec. S5 (discussion after Eq. S31)] The claim that the broken helix has |v_n·s|^2 ≠ |v_n·c|^2 for some n is asserted rather than derived. For a conventional six-fold helix this quantity vanishes identically, so this is exactly the step that distinguishes the broken helix from the helical case and underpins the central conclusion f_G ∝ H. Please provide the explicit six-spin configuration θ_j for the broken helix of EuIn2As2 and evaluate Q = s^T ρ^{-1}s − c^T ρ^{-1}c (or the Fourier amplitudes |v_n·s|^2 − |v_n·c|^2), or perform a numerical linear spin-wave calculation on a model of the broken helix to extract the low-field frequency exponent directly.
  2. [Supplemental Material, Sec. S5 (Eq. S31)] The variational upper bound λ0(H) ≤ (H^2/2N)Q + O(H^3) does not prove that the true lowest Hessian eigenvalue is of order H^2; a nonzero upper bound is compatible with a ground-state fluctuation energy that vanishes faster than H^2. A matching lower bound, or an explicit solution of the linearized dynamics for the broken helix, is needed to establish that the leading coefficient in f_G^2 is nonzero. Without it, the symmetry argument alone leaves open the possibility f_G ∝ H^2, which would contradict the experimental data.
minor comments (3)
  1. [Main text, Fig. 3 caption] The caption states that the purple line is a linear fit 'from H = 0 → Hhf', but the text claims the Goldstone frequency remains linear up to Hsat; please clarify the fit range and, if appropriate, show the fit over the full linear region.
  2. [Main text, Fig. 3] The data points in Fig. 3 appear without error bars; since the frequencies are extracted from fits to FFTs, providing uncertainties would strengthen the quantitative case for linear scaling.
  3. [Supplemental Material, Eq. (S21)] In Eq. (S21), the summation over bk should act on m_k^b, but the expression as written has m_j^b; please correct the index typo so that the linearized equation of motion is unambiguous.

Circularity Check

0 steps flagged · score 2.0 of 10

No significant circularity: the symmetry analysis is independent of the data, though the nonzero O(H^2) coefficient in the microscopic model is asserted rather than derived.

full rationale

The central derivation is not circular. The symmetry argument uses only the point-group symmetry of the zero-field broken-helix ground state to constrain the characteristic polynomial p(f,H). It shows that for a C2z-symmetric magnet f_G^2(H) can begin at O(H^2), so f_G ~ H is the lowest symmetry-allowed order. This is a symmetry classification, not a fit: no parameter is adjusted to the measured f_G(H), and the experimental observation is used as confirmation rather than as an input. The claim is therefore not a fitted input renamed as a prediction. The main gap is in SM Sec. S5, Eq. (S31), where the authors derive only a variational upper bound for the lowest Hessian eigenvalue and then assert, without displaying the broken-helix spin configuration or evaluating the expression, that |v_n·s|^2 ≠ |v_n·c|^2 for some n, so that the O(H^2) coefficient is nonzero. This is a load-bearing but unproved assertion; if the coefficient vanished, the easy-plane model would give f_G ~ H^2. However, this is a missing derivation or numerical check, not a circular reduction: the quantity is not defined in terms of the measured frequency, and the symmetry statement does not by itself force the coefficient to be nonzero. There is a minor self-citation to Ref. [18] for the strain pinning of the nematic director and the near-perfect U(1) symmetry of EuIn2As2, but the core symmetry analysis does not reduce to that citation, and the broken-helix structure itself is established by external references [19-21]. Thus, by the strict standard of exhibiting a specific equation-to-equation or fit-to-prediction reduction, no significant circularity is present.

Assumptions & free parameters 0 free parameters · 5 assumptions · 0 invented entities

The central symmetry argument relies on the assumed C2z symmetry of the broken helix and the smooth deformation of the ground state with field. No new entities are introduced. The key fragility is the unproven assertion that the H^2 coefficient is nonzero for the broken helix.

assumptions (5)
  • domain assumption The broken helix ground state is invariant under C2z rotation about the c-axis.
    This symmetry is taken from prior characterization of EuIn2As2 (Refs. [18,19,20]) and is used to constrain the characteristic polynomial in Eq. (5).
  • standard math The characteristic polynomial p(f,H) is invariant under the point group operations of the magnetic ground state.
    This is a standard consequence of symmetry and is stated in SM Sec. S4.
  • domain assumption The ground state distorts smoothly with applied field, so the dynamical matrix D(H) and p(f,H) are analytic in H.
    Assumed in the Taylor expansion leading to Eq. (5).
  • standard math The Goldstone mode is non-degenerate at H=0, so the product in Eq. (4) has a nonzero constant factor.
    Needed to relate the field dependence of p to that of f_mu^2.
  • ad hoc to paper For the broken helix, s^T rho^{-1}s - c^T rho^{-1}c is nonzero.
    Asserted in SM Sec. S5 without a detailed calculation; this ensures the O(H^2) coefficient in the variational bound is nonzero.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Goldstone mode of the broken helix in U(1) magnet EuIn2As2." pith.science (2026). https://pith.science/paper/R2J3SEYY

@misc{pith2026250109084,
  author       = {Pith},
  title        = {Pith review of: Goldstone mode of the broken helix in U(1) magnet EuIn2As2},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/R2J3SEYY}},
  note         = {Machine review of arXiv:2501.09084}
}
abstract

Goldstone modes acquire a frequency gap in the presence of perturbations that break the underlying continuous symmetry. Here, we study the response of a spin-based Goldstone mode to strain and magnetic field in the broken helix, a multi-$\textbf{Q}$ phase of EuIn$_2$As$_2$. Optical polarimetry with spatial and temporal resolution allows us to access information about both the structure and frequency of optically excited spin-wave modes under different strain conditions. We observe nearly uniform spin precession characteristic of a Goldstone mode only when magnetic field dominates over strain. In this regime, the frequency depends linearly on the applied field. A symmetry analysis for predicting the mode frequency near zero field demonstrates that the observed scaling is of the lowest allowed order. This work thus demonstrates the connections between magnetic symmetries and the frequency dependence of the Goldstone mode in an external field, and illustrates the power of our technique for studying the dynamics of complex magnets.

Figures

Figures reproduced from arXiv: 2501.09084 by the authors.

Figure 1
Figure 1. (a) Structural unit cell of EuIn2As2. (b) Top view of the broken helix, with orange arrows representing the spin orientation in each Eu plane of the magnetic unit cell, labeled 1-6. Purple double headed arrow represents the orientation of the nematic director η. (c) Schematic of the optical setup used for measurements of the polarization rotation δϕ as a function of incident polarization ϕ, time delay between pump a… view at source ↗
Figure 2
Figure 2. (a) Depiction of orientation of ηeq at positions A and B in zero field, relative to the axis of the applied field. (b) Definition of θeq, angle between H∥ (black arrow) and η A eq or η B eq. (c) Field dependence of the Goldstone mode frequency at positions A and B in the low-field regime at T = 3 K. Black lines indicate fits to f(H) = p f 2(0) + AH2, where A is the only fitting parameter. (d) θeq as a function of ap… view at source ↗
Figure 3
Figure 3. Magnetic field dependence of the frequency of the [PITH_FULL_IMAGE:figures/full_fig_p004_3.png] view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

31 extracted references · 26 canonical work pages

  1. [1]

    Kardar, Statistical Physics of Fields (Cambridge Uni- versity Press, 2007)

    M. Kardar, Statistical Physics of Fields (Cambridge Uni- versity Press, 2007)

    2007

  2. [2]

    B. I. Halperin and P. C. Hohenberg, Physical Review 188, 898 (1969)

    1969

  3. [3]

    B. I. Halperin and W. M. Saslow, Physical Review B 16, 2154 (1977)

    work page 1977

  4. [4]

    R. S. Fishman and S. H. Liu, Physical Review Letters 76, 2398 (1996)

    work page 1996

  5. [5]

    MacNeill, J

    D. MacNeill, J. T. Hou, D. R. Klein, P. Zhang, P. Jarillo- Herrero, and L. Liu, Physical Review Letters 123, 047204 (2019)

    work page 2019

  6. [6]

    Bedoya-Pinto, J.-R

    A. Bedoya-Pinto, J.-R. Ji, A. K. Pandeya, P. Gargiani, M. Valvidares, P. Sessi, J. M. Taylor, F. Radu, K. Chang, and S. S. P. Parkin, Science 374, 616 (2021)

    work page 2021

  7. [7]

    Tymoshenko, Y

    Y. Tymoshenko, Y. Onykiienko, T. M¨ uller, R. Thomale, S. Rachel, A. Cameron, P. Portnichenko, D. Efremov, V. Tsurkan, D. Abernathy, J. Ollivier, A. Schneidewind, A. Piovano, V. Felea, A. Loidl, and D. Inosov, Physical Review X 7, 041049 (2017)

    work page 2017

  8. [8]

    Grassi, M

    M. Grassi, M. Geilen, K. A. Oukaci, Y. Henry, D. La- cour, D. Stoeffler, M. Hehn, P. Pirro, and M. Bailleul, PHYSICAL REVIEW B 105, 094444 (2022), num Pages: 7 Place: College Pk Publisher: Amer Physical Soc Web of Science ID: WOS:000802804000005

    work page 2022

Show all 31 references
  1. [9]

    B. R. Cooper, R. J. Elliott, S. J. Nettel, and H. Suhl, Physical Review 127, 57 (1962)

    1962

  2. [10]

    B. R. Cooper and R. J. Elliott, Physical Review 131, 1043 (1963). 6

    1963

  3. [11]

    I. A. Zaliznyak and M. E. Zhitomirsky, JETP 81 (1995)

    1995

  4. [12]

    A. F. Andreev and V. I. Marchenko, Soviet Physics Us- pekhi 23 (1980)

    1980

  5. [13]

    Ziman and P.-A

    T. Ziman and P.-A. Lindgrd, Physical Review B 33, 1976 (1986)

    1986

  6. [14]

    F. J. Dos Santos, M. Dos Santos Dias, and S. Lounis, Physical Review B 102, 104436 (2020)

    2020

  7. [15]

    H. T. Diep, Symmetry 14, 1716 (2022)

    2022

  8. [16]

    Kittel, Physical Review 73, 155 (1948)

    C. Kittel, Physical Review 73, 155 (1948)

    1948

  9. [17]

    G. E. W. Bauer, P. Tang, M. Elyasi, Y. M. Blanter, and B. J. Van Wees, Physical Review B 108, 064431 (2023)

    2023

  10. [18]

    Donoway, T

    E. Donoway, T. Trevisan, A. Liebman-Pel´ aez, R. Day, K. Yamakawa, Y. Sun, J. Soh, D. Prabhakaran, A. Boothroyd, R. Fernandes, J. Analytis, J. Moore, J. Orenstein, and V. Sunko, Physical Review X 14, 031013 (2024)

    2024

  11. [19]

    S. X. Riberolles, T. V. Trevisan, B. Kuthanazhi, T. W. Heitmann, F. Ye, D. C. Johnston, S. L. Bud’ko, D. H. Ryan, P. C. Canfield, A. Kreyssig, A. Vishwanath, R. J. McQueeney, L. L. Wang, P. P. Orth, and B. G. Ueland, Nature Communications 12, 1 (2021), arXiv: 2007.12758

    2021

  12. [20]

    J.-R. Soh, A. Bombardi, F. Mila, M. C. Rahn, D. Prab- hakaran, S. Francoual, H. M. Rønnow, and A. T. Boothroyd, Nature Communications 14, 3387 (2023)

    2023

  13. [21]

    Incommensurate broken- helix and broken-fanlike states in axion insulator can- didate EuIn $ {2}$As$ {2}$,

    M. Gen, Y. Fujishiro, K. Okigami, S. Hayami, K. Adachi, D. Hashizume, T. Kurumaji, H. Sagayama, H. Nakao, Y. Tokura, and T.-h. Arima, “Incommensurate broken- helix and broken-fanlike states in axion insulator can- didate EuIn $ {2}$As$ {2}$,” (2024), arXiv:2403.03022 [cond-mat]

    2024 arXiv

  14. [22]

    Liu, Q.-Y

    H. Liu, Q.-Y. Wu, C. Zhang, J. Pang, B. Chen, J.-J. Song, Y.-X. Duan, Y.-H. Yuan, H.-Y. Liu, C.-C. Shu, Y.-F. Xu, Y.-G. Shi, and J.-Q. Meng, Physical Review B 110, 195104 (2024)

    2024

  15. [23]

    Q. Wu, T. Hu, D. Wu, R. Li, L. Yue, S. Zhang, S. Xu, Q. Liu, T. Dong, and N. Wang, Physical Review B 107, 174411 (2023)

    2023

  16. [24]

    S. M. Rezende, A. Azevedo, and R. L. Rodr ´ ıguez-Su´ arez, Journal of Applied Physics 126, 151101 (2019)

    2019

  17. [25]

    Y. Sun, F. Meng, C. Lee, A. Soll, H. Zhang, R. Ramesh, J. Yao, Z. Sofer, and J. Orenstein, Nature Physics (2024), 10.1038/s41567-024-02387-2

    2024 doi

  18. [26]

    Supplemental Materials,

    “Supplemental Materials,”

  19. [27]

    Sunko, Y

    V. Sunko, Y. Sun, M. Vranas, C. C. Homes, C. Lee, E. Donoway, Z.-C. Wang, S. Balguri, M. B. Mahen- dru, A. Ruiz, B. Gunn, R. Basak, S. Blanco-Canosa, E. Schierle, E. Weschke, F. Tafti, A. Frano, and J. Oren- stein, Physical Review B 107, 144404 (2023)

    2023

  20. [28]

    R. S. Fishman, T. R˜ o˜ om, and R. de Sousa, Physical Review B 99, 064414 (2019). 7 Figure S1. (a) Expanded schematic of the optical setup. HWP: half wave plate; WP: Wollaston prism; BPD: balanced photodiodes. HWP1, which is used to set initial polarization, is not shown. (b) ...

    2019

  21. [29]

    peak data

    In so doing, we redefine δη/r 0 → δη and δξ/r 0 → δξ such that δη and δξ are in dimensions of radians. Note that since δϕ is proportional to the ratio of two measured intensities ( ˜S and |r0|2 ≈ |EV |2 + |EH |2)), we need not measure intensities in absolute units. We also not...

  22. [30]

    local” frame for each site j. For a spin in the “local

    Inserting this ansatz into δE, and working to second order in H, we are left with δE = 1 2 H 2 X j<k Jjk cos[θ(0) j − θ(0) k ](χj − χk)2 (S27) + H 2m X j cos[θ(0) j ]χj − 1 2 H 2m2 X j sin[θ(0) j ]θ(1) j + O(H 3). This expression depends only on the first order cor- rection to...

  23. [31]

    Fig. S5a-b show the field dependence of the Goldstone mode frequency for various in-plane angles of the mag- net field spanning 0 ◦ to 90 ◦ for Kx = 0 .005, Khex = 0 16 and Kx = 0 , Khex = 3 .125 × 10−4 respectively. These parameters were chosen such that the zero field gap is...

Pith tools

Reviewed August 10, 2026 · model on record in the stance chip above.