Pith. sign in

REVIEW 1 major objections 1 minor 59 references

Atom Probe Tomography as an Emerging Tool for Understanding Defect-driven Mechanisms in HfO$_{2}$-based Ferroelectrics

T0 review · 1 major / 1 minor · reviewed 2026-06-27 · grok-4.3

Pith's one-line read Atom probe tomography can map individual dopants, oxygen-vacancy clusters, and interfacial segregation in HfO2-based ferroelectrics at atomic scale.

desk verdict This perspective pushes APT for 3D defect mapping in HfO2 ferroelectrics but the POC reconstruction supplies no accuracy numbers or controls for known oxide artifacts. read the letter →

arxiv 2606.16512 v2 pith:RLD4NLVH submitted 2026-06-15 cond-mat.mtrl-sci

classification cond-mat.mtrl-sci
keywords hafniaferroelectricsatomprobetomographyoxygenvacanciesdefectmappingferroelectricdevicesCMOSmemoryinterfacialsegregationwake-upeffect
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper argues that established techniques fall short in delivering three-dimensional, atomic-resolution views of all species inside hafnia ferroelectric stacks, leaving the links between defects and functional behavior incompletely quantified. It positions atom probe tomography as the method capable of resolving those species in device-relevant geometries. If the approach succeeds, it would turn qualitative defect models into quantitative relations that directly inform phase stability, wake-up, fatigue, and imprint. The perspective supplies a proof-of-concept reconstruction and reviews the remaining experimental hurdles. A sympathetic reader would therefore see APT as the missing measurement that converts defect engineering from trial-and-error into a design variable.

What carries the argument

Atom probe tomography (APT) for three-dimensional, atomic-scale chemical mapping of all constituent species inside ferroelectric device stacks.

What would settle it

A set of APT reconstructions on the same hafnia stack that show inconsistent dopant or vacancy positions when cross-checked against transmission-electron-microscopy or secondary-ion-mass-spectrometry depth profiles.

Watch

Extended reading notes

Core claim

By resolving individual dopants, vacancy clustering, and interfacial segregation in three dimensions, atom probe tomography can supply the quantitative defect maps needed to establish direct defect-property relations that govern polar-phase stabilization, wake-up, fatigue, and imprint in HfO2-based ferroelectrics.

Load-bearing premise

That sample-preparation, reconstruction-fidelity, and data-interpretation difficulties can be solved well enough to yield reliable atomic-scale maps inside actual device stacks.

Editorial extensions

If this is right

  • Quantitative maps of oxygen-vacancy clusters would allow direct testing of proposed mechanisms for the wake-up effect.
  • Interfacial segregation profiles would constrain models of imprint and retention loss.
  • Dopant distributions at the atomic level would guide doping strategies that stabilize the desired polar phase.
  • Three-dimensional defect statistics would replace averaged or two-dimensional proxies in reliability simulations.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • If APT succeeds on hafnia stacks it would likely be applied to other CMOS-compatible ferroelectrics such as doped zirconia or aluminum scandium nitride.
  • Routine APT on device stacks could shift defect engineering from post-fabrication analysis to in-line process control.
  • Combined APT and electrical measurements on the same nanoscale volume would test whether local defect density predicts local switching behavior.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

1 major / 1 minor

Summary. The manuscript is a Perspective proposing atom probe tomography (APT) as a tool for 3D atomic-scale mapping of oxygen vacancies, dopants, and interfacial segregation in HfO2-based ferroelectrics to enable quantitative defect-property relations. It reviews limitations of existing techniques, discusses experimental challenges for APT on oxides, presents a proof-of-concept atomic-scale reconstruction in a device stack, and outlines potential benefits for device reliability.

Significance. If the proposal is realized with validated quantitative mapping, APT could supply 3D compositional data on defect clustering and segregation that complements existing methods and accelerates optimization of wake-up, fatigue, and imprint in hafnia ferroelectrics. The perspective usefully identifies an application domain where APT's strengths in multi-species detection could address open questions.

major comments (1)
  1. [Proof-of-concept section / abstract] The proof-of-concept reconstruction (mentioned in the abstract and corresponding discussion) demonstrates atomic-scale imaging but supplies no metrics on composition accuracy, oxygen vs. hafnium detection efficiency, preferential evaporation control, or cluster identification fidelity. This is load-bearing for the central claim that APT can deliver quantitative defect-property relations, as reconstruction alone does not establish that vacancy or dopant distributions are reliably mapped in device stacks.
minor comments (1)
  1. [Challenges discussion] The discussion of APT challenges for ferroelectric oxides would benefit from explicit comparison to published APT results on other oxide systems (e.g., perovskites) to clarify what is HfO2-specific.

Simulated Author's Rebuttal

1 responses · 0 unresolved

We thank the referee for their thoughtful review and constructive comment on our Perspective manuscript. We address the major comment point by point below.

read point-by-point responses
  1. Referee: [Proof-of-concept section / abstract] The proof-of-concept reconstruction (mentioned in the abstract and corresponding discussion) demonstrates atomic-scale imaging but supplies no metrics on composition accuracy, oxygen vs. hafnium detection efficiency, preferential evaporation control, or cluster identification fidelity. This is load-bearing for the central claim that APT can deliver quantitative defect-property relations, as reconstruction alone does not establish that vacancy or dopant distributions are reliably mapped in device stacks.

    Authors: We agree that the proof-of-concept section demonstrates atomic-scale reconstruction in a device stack but does not include quantitative metrics on composition accuracy, detection efficiencies, or cluster fidelity. As this is a Perspective proposing APT as an emerging tool rather than a methods validation study, the reconstruction serves to illustrate feasibility of 3D atomic-scale imaging in hafnia stacks. We acknowledge that this limits the strength of claims regarding immediate quantitative defect mapping. We will revise the manuscript to (i) explicitly state the qualitative nature of the current proof-of-concept, (ii) discuss known APT challenges for oxides (preferential evaporation, oxygen detection efficiency) with references to the literature, and (iii) outline the additional calibration and validation steps required to achieve reliable vacancy/dopant quantification. This will better align the text with the Perspective scope while addressing the concern. revision: partial

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: perspective review with no derivations or self-referential predictions

full rationale

The manuscript is a perspective article that reviews existing characterization limitations and proposes APT for defect mapping in HfO2 ferroelectrics, supported by a brief proof-of-concept mention. It contains no equations, fitted parameters, predictions, or derivation chains of any kind. No self-citations function as load-bearing uniqueness theorems or ansatzes. The central claim is a forward-looking suggestion rather than a result derived from prior inputs within the paper. This matches the default expectation of no significant circularity for non-derivational review/proposal texts.

Assumptions & free parameters 0 free parameters · 0 assumptions · 0 invented entities

No free parameters, axioms, or invented entities are introduced; the paper is a technique-proposal perspective rather than a modeling or derivation effort.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Atom Probe Tomography as an Emerging Tool for Understanding Defect-driven Mechanisms in HfO$_{2}$-based Ferroelectrics." pith.science (2026). https://pith.science/paper/RLD4NLVH

@misc{pith2026260616512,
  author       = {Pith},
  title        = {Pith review of: Atom Probe Tomography as an Emerging Tool for Understanding Defect-driven Mechanisms in HfO$_2$-based Ferroelectrics},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/RLD4NLVH}},
  note         = {Machine review of arXiv:2606.16512}
}
abstract

HfO$_{2}$-based ferroelectrics are essential for the next generation of CMOS-compatible memory and logic devices, yet their performance is governed by a complex interplay between oxygen vacancies, dopants, and structural defects that remains an active area of investigation. These defects shape the function-critical dynamic phenomena, such as polar phase stabilization, wake-up, fatigue, and imprint. In this Perspective, we review the limitations of established high-resolution structural characterization techniques and propose atom probe tomography (APT) as a powerful tool for the three-dimensional (3D), atomic-scale mapping of all constituent species in hafnia-based ferroelectric systems. By resolving individual dopants, vacancy clustering, and interfacial segregation, APT can facilitate a quantitative understanding of defect-property relations in hafnia-based ferroelectrics. We discuss current experimental challenges for APT application to ferroelectric oxides, demonstrate a proof-of-concept of atomic-scale reconstruction in a hafnia-based device stack, and highlight the potential of APT to guide the development of ferroelectric structures with enhanced reliability and performance.

Figures

Figures reproduced from arXiv: 2606.16512 by the authors.

Figure 2
Figure 2. A wide range of microscopy and spectroscopy techniques has been applied to investigate HfO₂ systems. Macroscopic polarization values and their evolution as a function of a.c. cycling are measured using PUND, a switching-based method that averages over the entire sample. Bonding states and interface chemistry are probed by XPS, which is surface-sensitive and localized to planar regions. The atomic structure at interf… view at source ↗
Figure 3
Figure 3. Schematics of APT analysis. First, a bulk sample is shaped into a nanoscale needle, with a tip radius of about 50 nm. After applying an electrical bias, surface atoms are ionized and evaporated from the specimen and recorded at the detector. Using the time-of-flight and trajectory, a 3D reconstruction of the atomic distribution can be made. In contrast to metals, the application of APT to complex oxides has only rec… view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

59 extracted references · 1 canonical work pages

  1. [1]

    Kittl, J. A. et al. High-k dielectrics for future generation memory devices (Invited Paper). Microelectron. Eng. 86, 1789–1795 (2009)

  2. [2]

    S., Müller, J., Bräuhaus, D., Schröder, U

    Böscke, T. S., Müller, J., Bräuhaus, D., Schröder, U. & Böttger, U. Ferroelectricity in hafnium oxide thin films. Appl. Phys. Lett. 99, 102903 (2011)

  3. [3]

    Schroeder, U., Hwang, C. S. & Funakubo, H. Ferroelectricity in Doped Hafnium Oxide. (Elsevier, 2025). doi:10.1016/C2023-0-51447-8

  4. [4]

    Müller, J. et al. Ferroelectricity in simple binary ZrO 2 and HfO2. Nano Lett. 12, 4318–4323 (2012)

  5. [5]

    H., Mikolajick, T

    Schroeder, U., Park, M. H., Mikolajick, T. & Hwang, C. S. The fundamentals and applications of ferroelectric HfO2. Nat. Rev. Mater. 7, 653–669 (2022)

  6. [6]

    & Acuautla, M

    Noheda, B., Nukala, P. & Acuautla, M. Lessons from hafnium dioxide-based ferroelectrics. Nat. Mater. 22, 562–569 (2023)

  7. [7]

    Ma, L. Y. & Liu, S. Structural Polymorphism Kinetics Promoted by Charged Oxygen Vacancies in HfO2. Phys. Rev. Lett. 130, 096801 (2023)

  8. [8]

    Zhang, L. et al. Mapping electric fields and observation of ferroelectric domain switching in hafnia-zirconia devices by electron holography. Nat. Commun. 16, 11233 (2025)

Show all 59 references
  1. [9]

    Yang, W. et al. Effect and mechanism of point charge defects on ferroelectric domain switching properties of HfO2-based ferroelectric thin film. Comput. Mater. Sci. 213, 111607 (2022)

  2. [10]

    Park, M. H. et al. Ferroelectricity and Antiferroelectricity of Doped Thin HfO2- Based Films. Adv. Mater. 27, 1811–1831 (2015)

  3. [11]

    Park, J. Y. et al. Revival of Ferroelectric Memories Based on Emerging Fluorite- Structured Ferroelectrics. Adv. Mater. 35, 2204904 (2023)

  4. [12]

    Mikolajick, T. et al. Next generation ferroelectric materials for semiconductor process integration and their applications. J. Appl. Phys. 129, 100901 (2021)

  5. [13]

    H., Karpov, I., Olsson, R

    Kim, K. H., Karpov, I., Olsson, R. H. & Jariwala, D. Wurtzite and fluorite ferroelectric materials for electronic memory. Nat. Nanotechnol. 18, 422–441 (2023)

  6. [14]

    Defect chemistry in metal oxides

    Kofstad, P. Defect chemistry in metal oxides. Phase Transitions 58, 75–93 (1996)

  7. [15]

    Smyth, D. M. Defects and Order in Perovskite-Related Oxides. Annu. Rev. Mater. Sci. 15, 329–357 (1985)

  8. [16]

    Tuller, H. L. & Bishop, S. R. Point defects in oxides: Tailoring materials through defect engineering. Annu. Rev. Mater. Res. 41, 369–398 (2011). 14

  9. [17]

    Queisser, H. J. & Haller, E. E. Defects in semiconductors: Some fatal, some vital. Science. 281, 945–950 (1998)

  10. [18]

    V., Chen, Y

    Gunkel, F., Christensen, D. V., Chen, Y. Z. & Pryds, N. Oxygen vacancies: The (in)visible friend of oxide electronics. Appl. Phys. Lett. 116, 120505 (2020)

  11. [19]

    D., Rossetti, G

    Batra, R., Huan, T. D., Rossetti, G. A. & Ramprasad, R. Dopants Promoting Ferroelectricity in Hafnia: Insights from a comprehensive Chemical Space Exploration. Chem. Mater. 29, 9102–9109 (2017)

  12. [20]

    Materano, M. et al. Interplay between oxygen defects and dopants: Effect on structure and performance of HfO 2-based ferroelectrics. Inorg. Chem. Front. 8, 2650–2672 (2021)

  13. [21]

    & Liu, S

    Zhu, T., Ma, L., Deng, S. & Liu, S. Progress in computational understanding of ferroelectric mechanisms in HfO

  14. [22]

    npj Comput. Mater. 10, 188 (2024)

  15. [23]

    Zhou, D. et al. Wake-up effects in Si-doped hafnium oxide ferroelectric thin films. Appl. Phys. Lett. 103, 192904 (2013)

  16. [24]

    A., Glaum, J., Hoffmann, M

    Genenko, Y. A., Glaum, J., Hoffmann, M. J. & Albe, K. Mechanisms of aging and fatigue in ferroelectrics. Mater. Sci. Eng. B 192, 52–82 (2015)

  17. [25]

    Pešić, M. et al. Physical Mechanisms behind the Field-Cycling Behavior of HfO 2- Based Ferroelectric Capacitors. Adv. Funct. Mater. 26, 4601–4612 (2016)

  18. [26]

    Lu, H. et al. Electrically induced cancellation and inversion of piezoelectricity in ferroelectric Hf0.5Zr0.5O2. Nat. Commun. 15, 860 (2024)

  19. [27]

    & Yoshimura, T

    Takada, K., Takarae, S., Shimamoto, K., Fujimura, N. & Yoshimura, T. Time- Dependent Imprint in Hf0.5Zr0.5O2 Ferroelectric Thin Films. Adv. Electron. Mater. 7, 2100151 (2021)

  20. [28]

    Fengler, F. P. G., Hoffmann, M., Slesazeck, S., Mikolajick, T. & Schroeder, U. On the relationship between field cycling and imprint in ferroelectric Hf 0.5Zr0.5O2. J. Appl. Phys. 123, 204101 (2018)

  21. [29]

    Wei, T. et al. Three-Dimensional Reconstruction of Conductive Filaments in HfOx. Adv. Mater. 35, 2209925 (2023)

  22. [30]

    Nukala, P. et al. Reversible oxygen migration and phase transitions in hafnia-based ferroelectric devices. Science. 372, 630–635 (2021)

  23. [31]

    Szyjka, T. et al. Enhanced ferroelectric polarization in TiN/HfO2/TiN capacitors by interface design. ACS Appl. Electron. Mater. 2, 3152–3159 (2020)

  24. [32]

    Alcala, R. et al. The Electrode-Ferroelectric Interface as the Primary Constraint on Endurance and Retention in HZO-Based Ferroelectric Capacitors. Adv. Funct. Mater. 33, 2303261 (2023)

  25. [33]

    Tasneem, N. et al. Remote Oxygen Scavenging of the Interfacial Oxide Layer in 15 Ferroelectric Hafnium-Zirconium Oxide-Based Metal-Oxide-Semiconductor Structures. ACS Appl. Mater. Interfaces 14, 43897–43906 (2022)

  26. [34]

    Hamouda, W. et al. Physical chemistry of the TiN/Hf0.5Zr0.5O2 interface. J. Appl. Phys. 127, 064105 (2020)

  27. [35]

    & Böttger, U

    Starschich, S., Menzel, S. & Böttger, U. Evidence for oxygen vacancies movement during wake-up in ferroelectric hafnium oxide. Appl. Phys. Lett. 108, 032903 (2016)

  28. [36]

    Lee, J. et al. Role of oxygen vacancies in ferroelectric or resistive switching hafnium oxide. Nano Converg. 10, 1–39 (2023)

  29. [37]

    Li, C. et al. Dynamic observation of oxygen vacancies in hafnia layer by in situ transmission electron microscopy. Nano Res. 8, 3571–3579 (2015)

  30. [38]

    R., Chernikova, A

    Khakimov, R. R., Chernikova, A. G., Koroleva, A. A. & Markeev, A. M. On the Reliability of HZO-Based Ferroelectric Capacitors: The Cases of Ru and TiN Electrodes. Nanomaterials 12, 3059 (2022)

  31. [39]

    W., Fina, I., Sánchez, F., Bakaul, S

    Adkins, J. W., Fina, I., Sánchez, F., Bakaul, S. R. & Abiade, J. T. Thermal evolution of ferroelectric behavior in epitaxial Hf 0.5Zr0.5O2. Appl. Phys. Lett. 117, 142902 (2020)

  32. [40]

    Calka, P. et al. Chemical and structural properties of conducting nanofilaments in TiN/HfO2-based resistive switching structures. Nanotechnology 24, 085706 (2013)

  33. [41]

    Gault, B. et al. Atom probe tomography. Nat. Rev. Methods Prim. 1, 1–30 (2021)

  34. [42]

    & Pareigea, P

    Blavette, D., Duguaya, S. & Pareigea, P. Atom probe tomography: From physical metallurgy towards microelectronics. Int. J. Mater. Res. 102, 1074–1081 (2011)

  35. [43]

    Barnes, J. P. et al. Atom probe tomography for advanced nanoelectronic devices: Current status and perspectives. Scr. Mater. 148, 91–97 (2018)

  36. [44]

    & Pérez-Huerta, A

    Cappelli, C., Smart, S., Stowell, H. & Pérez-Huerta, A. Exploring Biases in Atom Probe Tomography Compositional Analysis of Minerals. Geostand. Geoanalytical Res. 45, 457–476 (2021)

  37. [45]

    Reddy, S. M. et al. Atom Probe Tomography: Development and Application to the Geosciences. Geostand. Geoanalytical Res. 44, 5–50 (2020)

  38. [46]

    & Ringer, S

    Gault, B., Moody, M., Cairney, J. & Ringer, S. Atom probe tomography. (Springer, New York, NY, 2012)

  39. [47]

    J., Prosa, T

    Larson, D. J., Prosa, T. J., Perea, D. E., Inoue, K. & Mangelinck, D. Atom probe tomography of nanoscale electronic materials. MRS Bull. 41, 30–34 (2016)

  40. [48]

    Hunnestad, K. A. et al. Atomic-scale 3D imaging of individual dopant atoms in an oxide semiconductor. Nat. Commun. 13, 4783 (2022). 16

  41. [49]

    Xu, X. et al. Variability and origins of grain boundary electric potential detected by electron holography and atom-probe tomography. Nat. Mater. 19, 887–893 (2020)

  42. [50]

    Hunnestad, K. A. et al. Quantitative Mapping of Chemical Defects at Charged Grain Boundaries in a Ferroelectric Oxide. Adv. Mater. 35, 2302543 (2023)

  43. [51]

    Zhao, H. et al. Hydrogen trapping and embrittlement in high-strength Al alloys. Nature 602, 437–441 (2022)

  44. [52]

    Chen, Y.-S. et al. Atom Probe Tomography for the Observation of Hydrogen in Materials : A Review Atom Probe Tomography for the Observation of Hydrogen in Materials : A Review. Microsc. Microanal. 29, 1–15 (2022)

  45. [53]

    Kirchhofer, R. et al. Quantifying Compositional Homogeneity in Pb(Zr, Ti)O3 Using Atom Probe Tomography. J. Am. Ceram. Soc. 97, 2677–2697 (2014)

  46. [54]

    A., Meier, Q

    Gradauskaite, E., Hunnestad, K. A., Meier, Q. N., Meier, D. & Trassin, M. Ferroelectric Domain Engineering Using Structural Defect Ordering. Chem. Mater. 34, 6468–6475 (2022)

  47. [55]

    Hunnestad, K. A. et al. 3D oxygen vacancy distribution and defect-property relations in an oxide heterostructure. Nat. Commun. 15, 5400 (2024)

  48. [56]

    Panciera, F. et al. Three-dimensional distribution of Al in high-k metal gate: Impact on transistor voltage threshold. Appl. Phys. Lett. 100, 201909 (2012)

  49. [57]

    Lotharukpong, C. et al. Specimen preparation methods for elemental characterisation of grain boundaries and isolated dislocations in multicrystalline silicon using atom probe tomography. Mater. Charact. 131, 472–479 (2017)

  50. [58]

    Thompson, K. et al. In situ site-specific specimen preparation for atom probe tomography. Ultramicroscopy 107, 131–139 (2007)

  51. [59]

    Kim, S. H. et al. Atom probe analysis of BaTiO 3 enabled by metallic shielding. Scr. Mater. 229, 115370 (2023)

Pith tools

Reviewed June 27, 2026 · model on record in the stance chip above.