Dip and Buffering in a fast-slow system associated to Brain Lactacte Kinetics
classification
🧮 math.DS
q-bio.NC
keywords
analysismathematicalbrainbufferingdynamicalkineticslactacteproposed
read the original abstract
High-dimensional compartmental dynamical systems have been introduced to model brain metabolism. In this article, an approach is proposed to their mathematical analysis. Reductions of these models are obtained by replacing several compartments by a control term. The analysis focuses here on lactate kinetics. A mathematical analysis of the initial dip of lactacte, observed under stimulation, and of the periodic buffering, underlying the re- sponse to a repetitive sequence of identical stimuli, can be proposed. This mathematical analysis relies on asymptotics techniques of time multi-scaled dynamical systems such as averaging along slow manifolds.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.