Pith. sign in

REVIEW 4 major objections 5 minor 22 references

A Deep Learning Framework Integrating CNN and BiLSTM for Financial Systemic Risk Analysis and Prediction

T0 review · 4 major / 5 minor · reviewed 2026-08-08 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗

Pith's one-line read The paper claims that combining CNN and BiLSTM into one network identifies financial systemic risk more accurately than BiLSTM, CNN, Transformer, or TCN alone.

desk verdict Routine CNN+BiLSTM application with a single unverifiable performance table; the missing label definition makes the central claim unsupported. read the letter →

arxiv 2502.06847 v1 pith:SQKKVZC6 submitted 2025-02-07 cs.LG cs.CE

Yu Cheng , Zhen Xu , Yuan Chen , Yuhan Wang , Zhenghao Lin , Jinsong Liu This is my paper · ORCID
classification cs.LGcs.CE
keywords financialsystemicriskdeeplearningconvolutionalneuralnetworkbidirectionallongshort-termmemorytimeseriesclassificationpredictionhybridmodelattentionmechanism
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper tries to establish that a hybrid deep network, built by running a convolutional neural network and a bidirectional long short-term memory network in sequence, classifies financial systemic risk better than any of the individual architectures it is compared with. On a real financial market dataset, the authors report that the hybrid reaches 0.89 accuracy, 0.87 recall, and 0.88 F1-score, outperforming BiLSTM, CNN, Transformer, and TCN. The claim matters because systemic risk signals combine short local patterns with long-range temporal dependencies, and a model that captures both could give earlier or more reliable warnings in financial monitoring. The paper also treats the hybrid as a template for intelligent risk management, with future directions including reinforcement learning and multimodal data.

What carries the argument

The central object is the CNN–BiLSTM architecture: one-dimensional convolution kernels sweep across a normalized feature matrix of market variables to capture local patterns, a max-pooling layer reduces dimensionality, a bidirectional LSTM reads the resulting features in both time directions, and an attention layer weights the importance of each time step before a fully connected layer with a sigmoid output produces the risk probability. The mechanism doing the work is the division of labor—CNN handles local spatial structure, BiLSTM handles long-range temporal dependence, and attention selects which moments matter most for the risk decision.

What would settle it

Re-run the same CNN–BiLSTM architecture on a public financial dataset with an explicit labeling rule (for example, an index falling more than a stated threshold within a stated horizon), train each baseline under several random seeds, and check whether the hybrid's F1 advantage over Transformer and TCN disappears or drops below about two points; if it does, the paper's claim of general superiority is not supported.

Watch

Extended reading notes

Core claim

The paper's central claim is that the CNN–BiLSTM pipeline, in which CNN first extracts local features and BiLSTM then models forward and backward temporal dependencies, outperforms each component alone and two additional baselines on the authors' financial systemic risk identification task. Table 1 reports accuracy of 0.89, recall of 0.87, and F1-score of 0.88 for the proposed model, versus 0.86 accuracy and 0.85 F1-score for the strongest single baseline, the Transformer, and 0.84 accuracy and 0.83 F1-score for BiLSTM alone. The authors attribute the improvement to the combination of local feature extraction and bidirectional time-series modeling. They also present loss curves that drop steadily, while acknowledging a gap between training and validation loss that suggests some overfitting.

Load-bearing premise

The entire comparison rests on how a systemic risk event is labeled in the dataset, but the paper never states that labeling rule, the prediction horizon, or the exact size of the train, validation, and test windows.

Editorial extensions

If this is right

  • A financial risk classifier that couples local feature extraction with bidirectional sequence modeling can beat single CNN, BiLSTM, Transformer, and TCN models on the same data.
  • The reported gaps (about three accuracy and F1 points over the Transformer) imply the hybrid's advantage is large enough to matter in practice, but small enough that it should be tested on additional datasets.
  • The attention layer on the BiLSTM output provides a route to interpreting which historical time steps drive a given risk warning.
  • The visible gap between training and validation loss means regularization or early stopping could improve the model's generalization further.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Not stated in the paper, the order of the two components could be tested: a BiLSTM-first variant might behave differently on sequences where long-range context matters before local pattern extraction.
  • Not stated in the paper, the reported point scores lack uncertainty estimates, so rerunning the comparison across random seeds with confidence intervals is a natural check on whether the three-point margin over Transformer is stable.
  • Not stated in the paper, the labeling rule for a systemic risk event is the biggest unknown; testing the model under alternative definitions of the label and different prediction horizons would reveal how much of the F1 advantage is tied to the authors' specific setup.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 5 minor

Summary. The paper proposes a hybrid CNN-BiLSTM model for financial systemic risk classification, claiming superior accuracy, recall, and F1 over BiLSTM, CNN, Transformer, and TCN on a financial dataset. The manuscript describes the architecture, reports a single comparative experiment in Table 1 with F1=0.88, shows training/validation loss curves, and concludes that the combination of CNN and BiLSTM significantly improves systemic risk identification. The dataset is said to come from public sources such as Yahoo Finance, with features including closing prices, volumes, volatility, and interest rates.

Significance. If the reported results were reproducible and grounded in a clearly defined systemic-risk label, the paper would provide modest evidence for a useful hybrid architecture in financial risk identification. However, the current manuscript lacks essential experimental and methodological details: the target label is never defined, no hyperparameters are given, no variance estimates or significance tests are reported, and the architecture description is internally inconsistent. The central claim of superiority is therefore unsupported, and the contribution is limited to an underspecified proposal with unverifiable empirical evidence.

major comments (4)
  1. [IV.A] The paper never defines how the binary target variable for 'systemic risk' is constructed. Section IV.A lists input features and says the data were 'screened and cleaned' and divided via a 'time window division method,' but it does not state the labeling rule, the prediction horizon, or the sizes of the train/validation/test splits. Because the cross-entropy loss in Section III requires ground-truth labels, the accuracy, recall, and F1 values in Table 1 are not reproducible and the claimed advantage over the baselines is uninterpretable. This is a load-bearing omission.
  2. [IV.B, Table 1] The comparison reports only point estimates with no variance, confidence intervals, number of independent runs, or statistical significance tests. A single run cannot support the claim of 'significantly superior' made in the Abstract and Section V. The manuscript also omits all training hyperparameters (optimizer, learning rate, batch size, epochs, layer sizes, kernel sizes, split ratio), so the experimental comparison cannot be independently replicated.
  3. [I and III] The described order of the CNN and BiLSTM components is contradictory. Section I states that the framework 'first uses BiLSTM to extract time series features... and then performs multi-level convolution,' whereas Section III states that the model 'first extracts the local features of financial time series data through CNN and then uses BiLSTM to model its long-term dependencies' (see also Figure 1). This contradiction directly affects the claimed contribution of the proposed architecture and must be resolved.
  4. [III] The attention mechanism introduced in the method section (after the BiLSTM, with reference [18]) is not mentioned in the Abstract, Section V, or the description of the model in Table 1. If the final model includes attention, the comparison should describe that; if not, the attention text is misleading. In addition, the convolution formula and surrounding text do not specify the number of layers, kernel sizes, strides, or pooling dimensions, leaving the model specification incomplete.
minor comments (5)
  1. [I] The Introduction contains a typo, 'con trolling,' and inconsistent hyphenation such as 'real -time' and 'multi -level'; the manuscript would benefit from proofreading.
  2. [IV.B, Table 1] In Table 1, 'BILSTM' should be 'BiLSTM' for consistency with the rest of the text.
  3. [IV.B, Figure 2] The loss curves in Figure 2 are described qualitatively, but the figure lacks axis labels, a clear caption, and any numeric detail about epochs or loss values, which limits its usefulness.
  4. [IV.A] Reference [19], cited for the data cleaning method, concerns accessibility linked data and does not appear relevant to financial data cleaning; please verify or replace the citation.
  5. [II] Several works in the related-work section are only loosely connected to financial systemic risk (e.g., references on autoencoders, graph neural networks, and neural architecture search); the connections should be tightened or the discussion shortened.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity in the claimed derivation; the reported performance is an empirical result rather than an assumption of the model's own conclusion.

full rationale

The paper's central claim is that a CNN+BiLSTM hybrid achieves higher accuracy, recall, and F1 than BiLSTM, CNN, Transformer, and TCN on the authors' financial systemic-risk classification task. This is presented as an experimental outcome in Table 1, with standard model equations (convolution, BiLSTM hidden-state combination, sigmoid output, cross-entropy loss) that do not encode the reported superiority. No fitted parameter is renamed as a prediction: the model is trained on an undisclosed label but the advantage is not forced by the architecture equations themselves. The cited prior works are used for general motivation and baseline references, not to import a uniqueness theorem or to justify the conclusion; none is load-bearing for the claimed ranking. The absence of a precise definition of the ground-truth systemic-risk label, the absence of error bars, and the absence of statistical significance tests are serious evidence-quality and reproducibility problems, but they are not circularity under the stated criteria: they do not show that any claimed result is equivalent to its inputs by construction. Therefore the appropriate circularity score is 0; the concerns belong to correctness risk and reproducibility, not to circular reasoning.

Assumptions & free parameters 5 free parameters · 4 assumptions · 0 invented entities

The central claim rests on empirical unknowns: the risk label definition, the exact data set, and the training setup. No new theoretical entities are introduced.

free parameters (5)
  • CNN architecture hyperparameters (number of layers, kernel sizes, filters, pooling size)
    Not reported; they determine which local patterns the model extracts.
  • BiLSTM hidden units and number of layers
    Not reported; they set the temporal modeling capacity.
  • Training hyperparameters (optimizer, learning rate, batch size, epochs)
    Not reported; Table 1 can only be interpreted with these.
  • Time window length and train/validation/test split ratio
    Section IV.A mentions time-window division but gives no sizes or dates; the split defines the evaluation.
  • All trainable weights and biases of the CNN and BiLSTM
    These are fit to data by gradient descent and are the core free parameters of the model, though none are given.
assumptions (4)
  • domain assumption The systemic risk labels in the dataset are correct and well-defined.
    Section IV.A never defines the target variable; without it, the classifier's output is unspecified.
  • domain assumption The dataset is representative of financial systemic risk and covers multiple economic cycles.
    The paper claims this in Section IV.A but provides no instruments, dates, or sample sizes.
  • standard math Gradient-based training with cross-entropy loss generalizes from the training window to the test window.
    Section III assumes standard training works; the paper itself notes a gap between training and validation loss in Section IV.B.
  • domain assumption The baseline models were given comparable hyperparameter tuning and training budgets.
    Section IV.B lists baselines but no configurations, so the comparison assumes fairness.

how reviews work

0 comments
Cite this review

Pith. "Pith review of A Deep Learning Framework Integrating CNN and BiLSTM for Financial Systemic Risk Analysis and Prediction." pith.science (2026). https://pith.science/paper/SQKKVZC6

@misc{pith2026250206847,
  author       = {Pith},
  title        = {Pith review of: A Deep Learning Framework Integrating CNN and BiLSTM for Financial Systemic Risk Analysis and Prediction},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/SQKKVZC6}},
  note         = {Machine review of arXiv:2502.06847}
}
read the original abstract

This study proposes a deep learning model based on the combination of convolutional neural network (CNN) and bidirectional long short-term memory network (BiLSTM) for discriminant analysis of financial systemic risk. The model first uses CNN to extract local patterns of multidimensional features of financial markets, and then models the bidirectional dependency of time series through BiLSTM, to comprehensively characterize the changing laws of systemic risk in spatial features and temporal dynamics. The experiment is based on real financial data sets. The results show that the model is significantly superior to traditional single models (such as BiLSTM, CNN, Transformer, and TCN) in terms of accuracy, recall, and F1 score. The F1-score reaches 0.88, showing extremely high discriminant ability. This shows that the joint strategy of combining CNN and BiLSTM can not only fully capture the complex patterns of market data but also effectively deal with the long-term dependency problem in time series data. In addition, this study also explores the robustness of the model in dealing with data noise and processing high-dimensional data, providing strong support for intelligent financial risk management. In the future, the research will further optimize the model structure, introduce methods such as reinforcement learning and multimodal data analysis, and improve the efficiency and generalization ability of the model to cope with a more complex financial environment.

Figures

Figures reproduced from arXiv: 2502.06847 by the authors.

Figure 1
Figure 1. Overall model architecture At the model input stage, we represent the time series data of the financial market as a multi-dimensional feature matrix, denoted as T F X R   , where T represents the time step and [PITH_FULL_IMAGE:figures/full_fig_p002_1.png] view at source ↗
Figure 2
Figure 2. Loss function changes with epoch As shown in the figure, the training loss and validation loss decrease progressively during the training process, indicating continuous model optimization and improved fitting to both training and validation data patterns. This trend shows that the learning process of the model is effective, the parameters are gradually adjusted during training, the loss function value is reduced, an… view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

22 extracted references · 19 canonical work pages

  1. [18]

    Fine -Grained Imbalanced Leukocyte Classification With Global -Local Attention Transformer,

    B. Chen, F. Qin, Y. Shao, J. Cao, Y. Peng and R. Ge, "Fine -Grained Imbalanced Leukocyte Classification With Global -Local Attention Transformer," Journal of King Saud University - Computer and Information Sciences, vol. 35, no. 8, Article ID 101661, 2023

    work page 2023

  2. [1]

    Analyze the Impact of the Epidemic on New York Taxis by Machine Learning Algorithms and Recommendations for Optimal Prediction Algorithms,

    Z. Liu, X. Xia, H. Zhang and Z. Xie, "Analyze the Impact of the Epidemic on New York Taxis by Machine Learning Algorithms and Recommendations for Optimal Prediction Algorithms," Proceedings of the 2021 3rd International Conference on Robotics Systems and Automation Engineering, pp. 46-52, May 2021

    work page 2021

  3. [2]

    Investigation of the Influence of Non -Routine and Derived Features in the Development of Early Detection Model for Transformer Health Index Classification

    A. Mohmad, M. H. M. Ariff, M. I. Shapiai, et al., "Investigation of the Influence of Non -Routine and Derived Features in the Development of Early Detection Model for Transformer Health Index Classification", Journal of Advanced Research in Applied Sciences and Engineering Technology, vol. 39, no. 2, pp. 141-152, 2024

    work page 2024

  4. [3]

    Accounting Management and Optimizing Production Based on Distributed Semantic Recognition

    R. Guo, S. Wang, and G. Wei, "Accounting Management and Optimizing Production Based on Distributed Semantic Recognition", IET Software, vol. 2024, no. 1, p. 8425877, 2024

    work page 2024

  5. [4]

    A Stock Price Prediction Method Based on Bi-LSTM and Improved Transformer

    K. Naresh and A. V. Akshaya, "A Stock Price Prediction Method Based on Bi-LSTM and Improved Transformer", 2024

    work page 2024

  6. [5]

    Integrating Deep Transformer and Temporal Convolutional Networks for SMEs Revenue and Employment Growth Prediction

    D. Lu, S. Schwartz, L. Xu, et al., "Integrating Deep Transformer and Temporal Convolutional Networks for SMEs Revenue and Employment Growth Prediction", Expert Systems with Applications, vol. 252, p. 124129, 2024

    work page 2024

  7. [6]

    Calibration Learning for Few -shot Novel Product Description,

    Z. Liu, M. Wu, B. Peng, Y. Liu, Q. Peng and C. Zou, "Calibration Learning for Few -shot Novel Product Description," Proceedings of the 46th International ACM SIGIR Conference on Research and Development in Information Retrieval, pp. 1864-1868, July 2023

    2023

  8. [7]

    Adaptive Receptive Field U -Shaped Temporal Convolutional Network for Vulgar Action Segmentation,

    J. Cao, R. Xu, X. Lin, F. Qin, Y. Peng and Y. Shao, "Adaptive Receptive Field U -Shaped Temporal Convolutional Network for Vulgar Action Segmentation," Neural Computing and Applications, vol. 35, no. 13, pp. 9593-9606, 2023

    work page 2023

Show all 22 references
  1. [8]

    Transforming Multidimensional Time Series into Interpretable Event Sequences for Advanced Data Mining

    X. Yan, Y. Jiang, W. Liu, D. Yi, and J. Wei, "Transforming Multidimensional Time Series into Interpretable Event Sequences for Advanced Data Mining", arXiv preprint, arXiv:2409.14327, 2024

    2024 arXiv

  2. [9]

    Optimized Convolutional Neural Network for Intelligent Financial Statement Anomaly Detection,

    X. Du, “Optimized Convolutional Neural Network for Intelligent Financial Statement Anomaly Detection,” Journal of Computer Technology and Software, vol. 3, no. 9, 2024

    2024

  3. [10]

    Integrative Analysis of Financial Market Sentiment Using CNN and GRU for Risk Prediction and Alert Systems,

    Y. Wu, M. Sun, H. Zheng, J. Hu, Y. Liang, and Z. Lin, “Integrative Analysis of Financial Market Sentiment Using CNN and GRU for Risk Prediction and Alert Systems,” Proceedings of the 2024 International Conference on Electronics and Devices, Computational Science (ICEDCS), pp. ...

    2024

  4. [11]

    An Automated Data Mining Framework Using Autoencoders for Feature Extraction and Dimensionality Reduction,

    Y. Liang, X. Li, X. Huang, Z. Zhang, and Y. Yao, “An Automated Data Mining Framework Using Autoencoders for Feature Extraction and Dimensionality Reduction,” arXiv preprint arXiv:2412.02211, 2024

    2024 arXiv

  5. [12]

    Time -Series Nested Reinforcement Learning for Dynamic Risk Control in Nonlinear Financial Markets,

    Y. Yao, “Time -Series Nested Reinforcement Learning for Dynamic Risk Control in Nonlinear Financial Markets,” Transactions on Computational and Scientific Methods, vol. 5, no. 1, 2025

    2025

  6. [13]

    Time Series Feature Redundancy Paradox: An Empirical Study Based on Mortgage Default Prediction,

    C. Huang and Y. Yang, “Time Series Feature Redundancy Paradox: An Empirical Study Based on Mortgage Default Prediction,” arXiv preprint arXiv:2501.00034, 2024

    2024 arXiv

  7. [14]

    Adaptive Transaction Sequence Neural Network for Enhanced Money Laundering Detection,

    S. Long, D. Yi, M. Jiang, M. Liu, G. Huang, and J. Du, “Adaptive Transaction Sequence Neural Network for Enhanced Money Laundering Detection,” Proceedings of the 2024 International Conference on Electronics and Devices, Computational Science (ICEDCS), pp. 447 - 451, 2024

    2024

  8. [15]

    The Synergistic Role of Deep Learning and Neural Architecture Search in Advancing Artificial Intelligence,

    X. Yan, J. Du, L. Wang, Y. Liang, J. Hu, and B. Wang, “The Synergistic Role of Deep Learning and Neural Architecture Search in Advancing Artificial Intelligence,” Proceedings of the 2024 International Conference on Electronics and Devices, Computational Science (ICEDCS), pp. 4...

    2024

  9. [16]

    Few -Shot Learning with Adaptive Weight Masking in Conditional GANs,

    J. Hu, Z. Qi, J. Wei, J. Chen, R. Bao, and X. Qiu, “Few -Shot Learning with Adaptive Weight Masking in Conditional GANs,” Proceedings of the 2024 International Conference on Electronics and Devices, Computational Science (ICEDCS), pp. 435-439, 2024

    2024

  10. [17]

    Stock Type Prediction Model Based on Hierarchical Graph Neural Network,

    J. Yao, Y. Dong, J. Wang, B. Wang, H. Zheng, and H. Qin, “Stock Type Prediction Model Based on Hierarchical Graph Neural Network,” Proceedings of the 2024 International Conference on Electronics and Devices, Computational Science (ICEDCS), pp. 426-430, 2024

    2024

  11. [19]

    Investigation of Creating Accessibility Linked Data Based on Publicly Available Accessibility Datasets

    Y. Li, X. Yan, M. Xiao, W. Wang and F. Zhang, "Investigation of Creating Accessibility Linked Data Based on Publicly Available Accessibility Datasets", Proceedings of the 2023 13th International Conference on Communication and Network Security, pp. 77-81, 2024

    2023

  12. [20]

    Optimizing Bidirectional Long Short - Term Memory Networks for Univariate Time Series Forecasting: A Comprehensive Guide

    M. Abotaleb and P. K. Dutta, "Optimizing Bidirectional Long Short - Term Memory Networks for Univariate Time Series Forecasting: A Comprehensive Guide", Hybrid Information Systems: Non -Linear Optimization Strategies with Artificial Intelligence, p. 443, 2024

    2024

  13. [21]

    Enhancing Supply Chain Resilience: A Deep Learning Approach to Late Delivery Risk Prediction

    K. Douaioui, R. Oucheikh, and C. Mabrouki, "Enhancing Supply Chain Resilience: A Deep Learning Approach to Late Delivery Risk Prediction", Proceedings of the 2024 4th International Conference on Innovative Research in Applied Science, Engineering and Technology (IRASET), IEEE,...

    2024

  14. [22]

    A Gold Price Prediction Model Based on Economic Indicators Using Temporal Convolution and Attention Mechanism

    X. Niu, W. Wang, X. Leng, et al., "A Gold Price Prediction Model Based on Economic Indicators Using Temporal Convolution and Attention Mechanism", Proceedings of the 2024 International Conference on Cloud Computing and Big Data, pp. 222-226, 2024

    2024

Pith tools

Reviewed August 8, 2026 · model on record in the stance chip above.