Pith. sign in

REVIEW

Light-induced cortical excitability reveals programmable shape dynamics in starfish oocytes

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2409.08651 v1 pith:TBLSHEHM submitted 2024-09-13 physics.bio-ph

classification physics.bio-ph
keywords dynamicsshapecellwavescellsdeformationsmechanicalcellular
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

Chemo-mechanical waves on active deformable surfaces are a key component for many vital cellular functions. In particular, these waves play a major role in force generation and long-range signal transmission in cells that dynamically change shape, as encountered during cell division or morphogenesis. Reconstituting and controlling such chemically controlled cell deformations is a crucial but unsolved challenge for the development of synthetic cells. Here, we develop an optogenetic method to elucidate the mechanism responsible for coordinating surface contraction waves that occur in oocytes of the starfish Patiria miniata during meiotic cell division. Using spatiotemporally-patterned light stimuli as a control input, we create chemo-mechanical cortical excitations that are decoupled from meiotic cues and drive diverse shape deformations ranging from local pinching to surface contraction waves and cell lysis. We develop a quantitative model that entails the hierarchy of chemical and mechanical dynamics, which allows to relate the variety of mechanical responses to optogenetic stimuli. Our framework systematically predicts and explains transitions of programmed shape dynamics. Finally, we qualitatively map the observed shape dynamics to elucidate how the versatility of intracellular protein dynamics can give rise to a broad range of mechanical phenomenologies. More broadly, our results pave the way toward real-time control over dynamical deformations in living organisms and can advance the design of synthetic cells and life-like cellular functions.

Discussion (0). Continue with ORCID to comment.

Pith tools