Pith. sign in

REVIEW 2 major objections 5 minor 3 cited by

Mixed QCD-EW corrections to the neutral-current Drell-Yan process

T0 review · 2 major / 5 minor · reviewed 2026-08-11 · deepseek-v4-flash

Pith's one-line read The complete mixed QCD-electroweak correction to neutral-current Drell-Yan production is now computed exactly, without pole approximation, over the full dilepton-mass range.

desk verdict Exact mixed QCD-EW corrections to NC Drell-Yan, well cross-checked and phenomenologically important; the Summary overclaims 'no approximation' given the admitted top-mass neglect, but that is a wording fix, not a fatal flaw. read the letter →

arxiv 2412.16095 v2 pith:V4XXEDJJ submitted 2024-12-20 hep-ph

classification hep-ph
keywords Drell-YanprocessmixedQCD-electroweakcorrectionsNNLOqTsubtractionforward-backwardasymmetryeffectiveweakmixingangledressedleptonsLHCprecisionphysics
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper reports the complete computation of the mixed strong-electroweak corrections, the term of order $O(\alpha_s \alpha)$, to the neutral-current Drell-Yan process, in which a lepton pair is produced through an off-shell photon or $Z$ boson in hadron collisions. The calculation is performed without any pole approximation and is claimed to hold across the entire range of dilepton invariant masses, from the $Z$ resonance to multi-TeV tails. The result matters for precision Standard Model studies because Drell-Yan data anchor measurements of the $W$ mass, the effective weak mixing angle, and proton parton distribution functions, and because percent-level corrections of this kind are needed to interpret high-luminosity LHC measurements. The mixed corrections are small for inclusive fiducial rates, around $-0.4\%$ for bare muons, but they reach several percent in kinematical regions, notably with a nontrivial shape distortion around the $Z$ peak and a correction growing to about $-5\%$ in the high-mass tail.

What carries the argument

The load-bearing mechanism is the transverse-momentum ($q_T$) subtraction identity $\mathrm{d}\sigma^{(1,1)}=H^{(1,1)}\otimes \mathrm{d}\sigma_{\rm LO}+[\mathrm{d}\sigma_R^{(1,1)}-\mathrm{d}\sigma_{\rm CT}^{(1,1)}]$, which splits the mixed correction into an infrared-finite hard coefficient $H^{(1,1)}$, a real-emission piece regulated by a cut $r_{\rm cut}$ on $q_T/m_{\mu\mu}$, and a counterterm that cancels the $r_{\rm cut}\to 0$ divergence. The new element is that $H^{(1,1)}$ and the counterterm are not derived from scratch; they are obtained by abelianising the NNLO QCD heavy-quark pair-production results, a route that works because the Drell-Yan final state is colour neutral, so final-state radiation is purely QED and the soft-parton structure simplifies. The two-loop virtual amplitude enters exactly, reduced to master integrals and evaluated through series expansions of the differential-equation method with the vector-boson masses kept complex in the complex-mass scheme.

What would settle it

Perform an independent calculation of the $O(\alpha_s \alpha)$ neutral-current Drell-Yan cross section in the same fiducial setup using a local infrared-subtraction method instead of $q_T$ slicing; if the $r_{\rm cut}\to 0$ limit differs from the abelianised prediction by more than the quoted Monte Carlo uncertainties, in particular in the quark-antiquark or quark-gluon channels, then the imported coefficient is incomplete. A sharper version is to compute the pure-soft region of the double-real and real-virtual amplitudes at fixed lepton mass and check analytically that the abelianised counterterm cancels all $\ln r_{\rm cut}$ and constant terms.

Watch

Extended reading notes

Core claim

The paper establishes that the $O(\alpha_s \alpha)$ contribution to the neutral-current Drell-Yan cross section $pp\to \mu^+\mu^-+X$ can be evaluated exactly, with no pole approximation and no restriction on the dilepton invariant mass, combining the exact two-loop virtual amplitude with all real-radiation and subtraction pieces. For bare muons in a standard 13.6 TeV fiducial setup, the mixed correction is $-0.4\%$ of the Born cross section, but the invariant-mass distribution shows a nontrivial pattern: nearly zero at the $Z$ peak, about $+4\%$ below the peak and $-2\%$ above it, where the simple factorised product of QCD and electroweak corrections fails. In the high-mass region above 150 GeV the correction becomes increasingly negative, reaching about $-5\%$ at 2 TeV, a size comparable to the statistical precision expected at the high-luminosity LHC. The forward-backward asymmetry receives mixed-correction shifts that are larger than the pure QCD shifts and grow with the rapidity of the dilepton system, which is relevant for future extractions of $\sin^2\theta_{\rm eff}$. The calculation also extends to dressed leptons, using the muon mass as a physical regulator of final-state collinear singularities, and the results can be extrapolated to the massless limit; comparison with an independent massless-lepton calculation agrees after a bug in the comparison calculation was corrected.

Load-bearing premise

The load-bearing premise is that the transverse-momentum subtraction hard coefficient and counterterm, imported from heavy-quark pair-production results by abelianisation, contain every soft and collinear contribution specific to the colourless muon-pair final state, a point the paper tests with $r_{\rm cut}$ and lepton-mass stability rather than by an independent derivation.

Editorial extensions

If this is right

  • Exact mixed QCD-electroweak corrections can now be included in Standard Model reference predictions across the full dilepton-mass range, removing a previously uncontrolled approximation in precision Drell-Yan phenomenology.
  • For bare muons, the mixed correction shifts the invariant-mass distribution by about $+4\%$ below the $Z$ peak and $-2\%$ above it, with an almost flat $-0.4\%$ effect on the fiducial cross section, and the factorised QCD $\times$ EW ansatz fails below the resonance.
  • In the high-mass region the correction becomes more negative with invariant mass, reaching about $-5\%$ at 2 TeV, a shift comparable to the expected high-luminosity LHC statistical precision that should be accounted for in new-physics searches and PDF fits.
  • Future template extractions of $\sin^2\theta_{\rm eff}$ from the forward-backward asymmetry need to include these corrections: the mixed shifts in the asymmetry are larger than the NLO QCD shifts and increase with dimuon rapidity.
  • Dressed-lepton predictions can be extrapolated to the massless-lepton limit, providing a benchmark for calculations and event generators that treat photon radiation with different recombination prescriptions.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Editorial inference: if the abelianised $q_T$-subtraction route is as complete as the $r_{\rm cut}$ and lepton-mass checks suggest, the same method should supply $O(\alpha_s \alpha)$ corrections for other colourless electroweak final states, such as diboson or Higgs production, once the corresponding two-loop amplitudes become available.
  • Editorial inference: the demonstration that a finite lepton mass can regulate final-state collinear QED singularities and then be extrapolated away suggests a general recipe for non-collinear-safe observables in other processes: compute with massive leptons, apply the recombination prescription, then take $m_\ell\to 0$ and adjust the photon-PDF scheme, avoiding ad hoc photon-isolation requirements
  • Editorial inference: the failure of the factorised ansatz below the $Z$ peak implies that shower-based predictions relying on multiplicative QCD $\times$ EW corrections should be benchmarked against the exact result bin by bin before claiming few-permille accuracy in the resonant region.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

2 major / 5 minor

Summary. The paper presents the computation of the O(alpha_s alpha) mixed QCD-electroweak corrections to the neutral-current Drell-Yan process pp -> mu+ mu- + X, using massive muons, exact two-loop amplitudes, and a qT-subtraction formalism obtained by abelianising the NNLO QCD heavy-quark pair production results. The authors give phenomenological results for bare muons in the resonant and high-invariant-mass regions, for the forward-backward asymmetry, and for dressed leptons, including a comparison with the massless-lepton calculation of Ref. [55]. The calculation is a parameter-free Standard Model prediction: no observable is fitted, and all couplings, masses, and PDFs are taken from external sources. The main methodological inputs are the two-loop amplitudes of Ref. [56], one-loop amplitudes checked with OpenLoops and Recola, and the Matrix framework for phase-space integration and subtraction.

Significance. If the result is correct, this is a milestone for precision Standard Model phenomenology: it provides the first complete computation of the mixed QCD-electroweak corrections to the neutral-current Drell-Yan process over the full invariant-mass range, including two-loop virtual effects. The paper contains several strong internal and external checks: pointwise agreement between OpenLoops and Recola, stable rcut extrapolations for two lepton masses, reproduction of NNLO QCD and NLO EW benchmark results, and a documented collaboration with the authors of Ref. [55] to identify and fix a bug in the independent massless calculation. These checks support the credibility of the central claim. The main caveat is that the Summary's assertion that the calculation 'does not rely on any approximation' is not literally consistent with the treatment of top-mass effects in the two-loop virtual corrections, as discussed below. The residual small discrepancy in the quark-photon channel also deserves a more explicit treatment, but it does not appear to affect the main quantitative conclusions.

major comments (2)
  1. [Summary (Sec. 5) and Sec. 2] The Summary's opening statement that 'Our calculation does not rely on any approximation and holds in the entire range of dilepton invariant masses' is not consistent with Sec. 2, where the authors state that in the two-loop virtual corrections 'we neglect top-mass effects.' The accompanying error estimate, based on the smallness of the bottom-quark density, applies only to bottom-initiated channels; top-mass effects in the two-loop virtual corrections to q qbar -> l+ l- are not suppressed by the bottom PDF, so the percent-level estimate does not cover the actual source of the approximation. Since the claim of exactness over the full m_mumu range is the paper's headline result, please either quantify the neglected top-mass dependence (for example by computing a representative two-loop virtual contribution with and without m_t) or reformulate the Summary to state that the calculation is complete at O(alpha_s alpha) except for the treatment of m_t in the two-loop virtual amplitude.
  2. [Sec. 4, Table 2] The comparison with the massless calculation of Ref. [55] leaves the quark-photon channel unresolved: the present result, sigma^(1,1) = -0.231(9) pb, is about 10% larger than the corresponding result of Ref. [55], and the authors write that they cannot assess the significance because Ref. [55] does not provide per-channel uncertainties. Since this comparison is one of the main validation pillars of the calculation, please report the uncertainty on the q-gamma contribution in a way that allows an assessment (including the numerical result of Ref. [55]), or provide an additional independent check of this channel. The small absolute size of the channel means this is not a reason to doubt the main results, but it should be resolved or explicitly carried as an uncertainty in the Summary.
minor comments (5)
  1. [References] Reference [6] is incomplete: it lists the title of the CMS W-mass measurement but has no arXiv identifier or DOI; please complete the entry.
  2. [Sec. 4, Eq. (14)] The notation dsigma^(0,1)_γγ,m_l=0 on the left-hand side and dsigma^(0,1)_γγ,m_l on the right-hand side is confusing; please define explicitly that the latter is the massive-theory result and that the logarithmic term is the scheme-compensation contribution from the photon PDF.
  3. [Fig. 7] In the bottom-left panel (quark-gluon channel), the tick labels on the horizontal axis appear garbled in the manuscript and are not readable; please regenerate the figure.
  4. [Sec. 3.3 and Fig. 5] The label 'NNLOMIX' is used inconsistently: the text defines it as including only mixed QCD-EW corrections on top of LO, but the figure legend appears to use the same label for the full NLOQCD+NLOEW+NNLOMIX prediction. Please clarify the notation in the figure caption.
  5. [Sec. 5] The Summary reports only the quark-gluon discrepancy with Ref. [55] as disappearing after the bug fix, but does not mention the residual quark-photon discrepancy discussed in Sec. 4; please add a sentence for completeness.

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity: the O(alpha_s alpha) prediction is assembled from external amplitudes, external PDFs and an established subtraction method; no fitted parameter is renamed as a prediction.

full rationale

The paper's central object is the differential cross section at O(alpha_s alpha), built from tree/one-loop amplitudes (OpenLoops, Recola), the two-loop virtual amplitude [56], and a qT-subtraction counterterm taken from the abelianised NNLO QCD heavy-quark framework [38,39,88-92]. None of these ingredients is defined in terms of the final cross section; the hard coefficient H(1,1) is imported from prior published computations and is not tuned to the neutral-current DY observable. The final numbers are parameter-free Standard Model predictions: all masses, couplings and PDFs are external inputs (Section 3). The paper also performs genuine internal and external consistency checks: rcut-extrapolation stability, lepton-mass power-suppression tests, agreement between two independent one-loop generators, and a channel-by-channel comparison with the independent calculation of Ref. [55], in which a discrepancy was traced to a bug in the other group's implementation. The self-citations (e.g., Refs. [38,39,52,54,92]) are methodological references rather than load-bearing assertions that the target result is true because the authors say so. The summary sentence 'Our calculation does not rely on any approximation' is in tension with the admitted neglect of top-mass effects in the two-loop virtual corrections (Section 2), but this is an accuracy/consistency issue, not circularity: the neglect is an approximation in the physics input, not a definition of the output. Likewise, the use of abelianisation for the subtraction counterterm is a stated assumption that could be wrong, but it is independently testable and was tested; it does not make the prediction equivalent to its input. No equation in the paper defines a predicted observable as the fitted parameter or as a self-citation. Hence no circular step is present.

Assumptions & free parameters 0 free parameters · 5 assumptions · 0 invented entities

The paper introduces no new particles, forces, or fitted quantities. All physics inputs (GF, mW, mZ, mH, mt, m_mu, CKM, PDFs) are taken from the prior literature, and the results are parameter-free Standard Model predictions. The only hand-set parameters are technical (rcut, lepton mass as a regulator), and their effects on the results are tested rather than tuned.

assumptions (5)
  • standard math Collinear factorization: the hadronic cross section is a convolution of proton PDFs with partonic cross sections, with QED and mixed QCD-QED collinear singularities reabsorbed into the PDFs.
    Invoked in Section 2 and the Introduction (paragraphs citing Refs. [67-71]); this is the standard QCD factorization theorem with QED corrections, applied at O(alpha_s alpha).
  • domain assumption qT subtraction and abelianisation: the O(alpha_s alpha) counterterm and hard coefficient H(1,1) obtained from NNLO QCD heavy-quark pair production via abelianisation correctly cancel all IR singularities for the colourless Drell-Yan final state.
    Section 2, Eq. (3) and the following paragraph; the derivation is imported from Refs. [38, 39, 92] rather than proven in this paper.
  • domain assumption Lepton mass regulates final-state collinear singularities with negligible power corrections at m_l = m_mu.
    Section 4, first paragraphs; the massless-limit extrapolation and the comparison to Ref. [55] depend on this. The authors test m_l = 1 GeV versus m_mu, but do not prove the power suppression analytically.
  • domain assumption Top-quark mass effects in the two-loop virtual corrections can be neglected; the remaining error is estimated at the percent level of the correction.
    Section 2, setup paragraph. This is an approximation inside the claimed 'exact' calculation, justified by the small bottom-quark density.
  • standard math Complex-mass scheme and G_mu renormalisation with on-shell inputs correctly define the electroweak Lagrangian and the treatment of the photon PDF reabsorption.
    Section 2, parameter list, and Eq. (14). Standard published scheme (Refs. [87, 120, 121]).

how reviews work

0 comments
Cite this review

Pith. "Pith review of Mixed QCD-EW corrections to the neutral-current Drell-Yan process." pith.science (2026). https://pith.science/paper/V4XXEDJJ

@misc{pith2026241216095,
  author       = {Pith},
  title        = {Pith review of: Mixed QCD-EW corrections to the neutral-current Drell-Yan process},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/V4XXEDJJ}},
  note         = {Machine review of arXiv:2412.16095}
}
read the original abstract

We report on the complete computation of the mixed QCD-electroweak corrections to the neutral-current Drell-Yan process. Our calculation holds in the entire range of dilepton invariant masses. We present phenomenological results for several kinematical distributions in the case of bare muons both in the resonant region and for high invariant masses. We also consider the forward-backward asymmetry, which is a key observable to measure the weak mixing angle. We finally extend our calculation to dressed leptons and compare our results in the massless limit to those available in the literature.

Figures

Figures reproduced from arXiv: 2412.16095 by the authors.

Figure 1
Figure 1. Predictions for the rapidity distribution (left) and the invariant-mass distribution [PITH_FULL_IMAGE:figures/full_fig_p008_1.png] view at source ↗
Figure 2
Figure 2. Same as Fig [PITH_FULL_IMAGE:figures/full_fig_p009_2.png] view at source ↗
Figure 3
Figure 3. Dimuon invariant-mass distribution, in the acceptance setup defined in Section [PITH_FULL_IMAGE:figures/full_fig_p010_3.png] view at source ↗
Figures from the paper (5 more)
Figure 4
Figure 4. Figure 4: Dimuon invariant-mass distribution, in the acceptance setup defined in Section [PITH_FULL_IMAGE:figures/full_fig_p011_4.png]
Figure 5
Figure 5. Figure 5: Theoretical predictions for the FB asymmetry for different slices of rapidity of the [PITH_FULL_IMAGE:figures/full_fig_p012_5.png]
Figure 6
Figure 6. Figure 6: The variation of AF B(mℓℓ) for a change of the weak mixing angle value by 19 · 10−5 . sufficient to consider a variation of the LO AF B(mℓℓ) asymmetry, which we present in [PITH_FULL_IMAGE:figures/full_fig_p014_6.png]
Figure 7
Figure 7. Figure 7: Mixed QCD–EW corrections σ (1,1) as functions of the parameter rcut in the quark– antiquark (top left), quark–gluon (bottom left), quark–photon (top right) and gluon–photon (bottom right) channels for two different values of the final-state lepton mass, mℓ = 1 GeV and …
Figure 8
Figure 8. Figure 8: As in Fig [PITH_FULL_IMAGE:figures/full_fig_p019_8.png]

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 3 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Fermionic Electroweak Two-Loop Corrections to Drell-Yan and Related Processes

    hep-ph 2025-12 conditional novelty 7.0 of 10

    The full NNLO electroweak corrections with closed fermion loops to e+e- → ffbar (and Drell-Yan) were calculated semi-numerically and found to modify NLO cross-sections by about 1%.

  2. Impact of Z-boson transverse-momentum resummation on PDF determination

    hep-ph 2026-07 conditional novelty 6.0 of 10

    N3LL' resummation is required to reconcile the 13 TeV ATLAS Z-pT spectrum with global PDF fits, but lowering the pT cut below 30 GeV is not yet supported.

  3. MATRIX HAWAII: PineAPPL interpolation grids with MATRIX

    hep-ph 2025-06 accept novelty 6.0 of 10

    Matrix Hawaii provides a public interface between PineAPPL and MATRIX that generates interpolation grids at NNLO QCD + NLO EW accuracy for a range of LHC processes, with sub-permille interpolation errors.

Reference graph

Works this paper leans on

121 extracted references · 10 canonical work pages · cited by 3 Pith papers

  1. [54]

    Bonciani, L

    R. Bonciani, L. Buonocore, M. Grazzini, S. Kallweit, N. Rana, F. Tramontano, and A. Vicini, Mixed Strong-Electroweak Corrections to the Drell-Yan Process, Phys. Rev. Lett. 128 (2022), no. 1 012002, [ arXiv:2106.11953]. 22

  2. [55]

    Buccioni, F

    F. Buccioni, F. Caola, H. A. Chawdhry, F. Devoto, M. Heller, A. von Manteuffel, K. Melnikov, R. R¨ ontsch, and C. Signorile-Signorile,Mixed QCD-electroweak corrections to dilepton production at the LHC in the high invariant mass region , arXiv:2203.11237

  3. [56]

    Armadillo, R

    T. Armadillo, R. Bonciani, S. Devoto, N. Rana, and A. Vicini, Two-loop mixed QCD-EW corrections to neutral current Drell-Yan , JHEP 05 (2022) 072, [arXiv:2201.01754]

  4. [1]

    Drell and T.-M

    S. Drell and T.-M. Yan, Massive Lepton Pair Production in Hadron-Hadron Collisions at High-Energies, Phys. Rev. Lett. 25 (1970) 316–320. [Erratum: Phys.Rev.Lett. 25, 902 (1970)]

  5. [2]

    Amoroso et al., Snowmass 2021 Whitepaper: Proton Structure at the Precision 18 Frontier, Acta Phys

    S. Amoroso et al., Snowmass 2021 Whitepaper: Proton Structure at the Precision 18 Frontier, Acta Phys. Polon. B 53 (2022), no. 12 12–A1, [ arXiv:2203.13923]

  6. [3]

    Aaboud et al., Measurement of the W -boson mass in pp collisions at √s = 7 TeV with the ATLAS detector , Eur

    ATLAS Collaboration, M. Aaboud et al., Measurement of the W -boson mass in pp collisions at √s = 7 TeV with the ATLAS detector , Eur. Phys. J. C 78 (2018), no. 2 110, [arXiv:1701.07240]. [Erratum: Eur.Phys.J.C 78, 898 (2018)]

  7. [4]

    Aaij et al., Measurement of the W boson mass , JHEP 01 (2022) 036, [ arXiv:2109.01113]

    LHCb Collaboration, R. Aaij et al., Measurement of the W boson mass , JHEP 01 (2022) 036, [ arXiv:2109.01113]

  8. [5]

    Aad et al., Measurement of the W-boson mass and width with the ATLAS detector using proton-proton collisions at √s = 7 TeV , arXiv:2403.15085

    ATLAS Collaboration, G. Aad et al., Measurement of the W-boson mass and width with the ATLAS detector using proton-proton collisions at √s = 7 TeV , arXiv:2403.15085

Show all 121 references
  1. [6]

    CMS Collaboration, Measurement of the W boson mass in proton-proton collisions at√s = 13 TeV ,

  2. [7]

    CDF, D0Collaboration, T. A. Aaltonen et al., Tevatron Run II combination of the effective leptonic electroweak mixing angle , Phys. Rev. D 97 (2018), no. 11 112007, [arXiv:1801.06283]

  3. [8]

    Aaij et al., Measurement of the forward-backward asymmetry in Z/γ ∗ → µ+µ− decays and determination of the effective weak mixing angle , JHEP 11 (2015) 190, [ arXiv:1509.07645]

    LHCb Collaboration, R. Aaij et al., Measurement of the forward-backward asymmetry in Z/γ ∗ → µ+µ− decays and determination of the effective weak mixing angle , JHEP 11 (2015) 190, [ arXiv:1509.07645]

  4. [9]

    ATLAS Collaboration, Measurement of the effective leptonic weak mixing angle using electron and muon pairs from Z-boson decay in the ATLAS experiment at √s = 8 TeV, ATLAS-CONF-2018-037 (7, 2018)

  5. [10]

    CMS Collaboration, Measurement of the Drell-Yan forward-backward asymmetry and of the effective leptonic weak mixing angle using proton-proton collisions at 13 TeV ,

  6. [11]

    NNPDF Collaboration, R. D. Ball, S. Carrazza, L. Del Debbio, S. Forte, Z. Kassabov, J. Rojo, E. Slade, and M. Ubiali, Precision determination of the strong coupling constant within a global PDF analysis , Eur. Phys. J. C 78 (2018), no. 5 408, [arXiv:1802.03398]

  7. [12]

    Aad et al., A precise determination of the strong-coupling constant from the recoil of Z bosons with the ATLAS experiment at √s = 8 TeV, arXiv:2309.12986

    ATLAS Collaboration, G. Aad et al., A precise determination of the strong-coupling constant from the recoil of Z bosons with the ATLAS experiment at √s = 8 TeV, arXiv:2309.12986

  8. [13]

    Altarelli, R

    G. Altarelli, R. Ellis, and G. Martinelli, Large Perturbative Corrections to the Drell-Yan Process in QCD, Nucl. Phys. B 157 (1979) 461–497

  9. [14]

    Hamberg, W

    R. Hamberg, W. van Neerven, and T. Matsuura, A complete calculation of the order α2 s correction to the Drell-Yan K factor, Nucl. Phys. B 359 (1991) 343–405. [Erratum: Nucl.Phys.B 644, 403–404 (2002)]

  10. [15]

    R. V. Harlander and W. B. Kilgore, Next-to-next-to-leading order Higgs production at hadron colliders, Phys. Rev. Lett. 88 (2002) 201801, [ hep-ph/0201206]. 19

  11. [16]

    Anastasiou, L

    C. Anastasiou, L. J. Dixon, K. Melnikov, and F. Petriello, Dilepton rapidity distribution in the Drell-Yan process at NNLO in QCD , Phys. Rev. Lett. 91 (2003) 182002, [hep-ph/0306192]

  12. [17]

    Anastasiou, L

    C. Anastasiou, L. J. Dixon, K. Melnikov, and F. Petriello, High precision QCD at hadron colliders: Electroweak gauge boson rapidity distributions at NNLO , Phys. Rev. D 69 (2004) 094008, [ hep-ph/0312266]

  13. [18]

    Melnikov and F

    K. Melnikov and F. Petriello, Electroweak gauge boson production at hadron colliders through O(α2 s), Phys. Rev. D 74 (2006) 114017, [ hep-ph/0609070]

  14. [19]

    Catani, L

    S. Catani, L. Cieri, G. Ferrera, D. de Florian, and M. Grazzini, Vector boson production at hadron colliders: a fully exclusive QCD calculation at NNLO , Phys. Rev. Lett. 103 (2009) 082001, [ arXiv:0903.2120]

  15. [20]

    Catani, G

    S. Catani, G. Ferrera, and M. Grazzini, W Boson Production at Hadron Colliders: The Lepton Charge Asymmetry in NNLO QCD , JHEP 05 (2010) 006, [ arXiv:1002.3115]

  16. [21]

    Dittmaier and M

    S. Dittmaier and M. Kr¨ amer,Electroweak radiative corrections to W boson production at hadron colliders , Phys. Rev. D 65 (2002) 073007, [ hep-ph/0109062]

  17. [22]

    Baur and D

    U. Baur and D. Wackeroth, Electroweak radiative corrections to p¯p → W ± → ℓ±ν beyond the pole approximation , Phys. Rev. D 70 (2004) 073015, [ hep-ph/0405191]

  18. [23]

    Zykunov, Radiative corrections to the Drell-Yan process at large dilepton invariant masses, Phys

    V. Zykunov, Radiative corrections to the Drell-Yan process at large dilepton invariant masses, Phys. Atom. Nucl. 69 (2006) 1522

  19. [24]

    Arbuzov, D

    A. Arbuzov, D. Bardin, S. Bondarenko, P. Christova, L. Kalinovskaya, G. Nanava, and R. Sadykov, One-loop corrections to the Drell-Yan process in SANC. I. The Charged current case, Eur. Phys. J. C 46 (2006) 407–412, [ hep-ph/0506110]. [Erratum: Eur.Phys.J.C 50, 505 (2007)]

  20. [25]

    Carloni Calame, G

    C. Carloni Calame, G. Montagna, O. Nicrosini, and A. Vicini, Precision electroweak calculation of the charged current Drell-Yan process , JHEP 12 (2006) 016, [hep-ph/0609170]

  21. [26]

    U. Baur, O. Brein, W. Hollik, C. Schappacher, and D. Wackeroth, Electroweak radiative corrections to neutral current Drell-Yan processes at hadron colliders , Phys. Rev. D 65 (2002) 033007, [ hep-ph/0108274]

  22. [27]

    Zykunov, Weak radiative corrections to Drell-Yan process for large invariant mass of di-lepton pair, Phys

    V. Zykunov, Weak radiative corrections to Drell-Yan process for large invariant mass of di-lepton pair, Phys. Rev. D 75 (2007) 073019, [ hep-ph/0509315]

  23. [28]

    Carloni Calame, G

    C. Carloni Calame, G. Montagna, O. Nicrosini, and A. Vicini, Precision electroweak calculation of the production of a high transverse-momentum lepton pair at hadron colliders, JHEP 10 (2007) 109, [ arXiv:0710.1722]. 20

  24. [29]

    Arbuzov, D

    A. Arbuzov, D. Bardin, S. Bondarenko, P. Christova, L. Kalinovskaya, G. Nanava, and R. Sadykov, One-loop corrections to the Drell–Yan process in SANC. (II). The Neutral current case, Eur. Phys. J. C 54 (2008) 451–460, [ arXiv:0711.0625]

  25. [30]

    Dittmaier and M

    S. Dittmaier and M. Huber, Radiative corrections to the neutral-current Drell-Yan process in the Standard Model and its minimal supersymmetric extension , JHEP 01 (2010) 060, [ arXiv:0911.2329]

  26. [31]

    C. Duhr, F. Dulat, and B. Mistlberger, Drell-Yan Cross Section to Third Order in the Strong Coupling Constant , Phys. Rev. Lett. 125 (2020), no. 17 172001, [arXiv:2001.07717]

  27. [32]

    X. Chen, T. Gehrmann, N. Glover, A. Huss, T.-Z. Yang, and H. X. Zhu, Di-lepton Rapidity Distribution in Drell-Yan Production to Third Order in QCD , arXiv:2107.09085

  28. [33]

    C. Duhr, F. Dulat, and B. Mistlberger, Charged current Drell-Yan production at N 3LO, JHEP 11 (2020) 143, [ arXiv:2007.13313]

  29. [34]

    Camarda, L

    S. Camarda, L. Cieri, and G. Ferrera, Drell-Yan lepton-pair production: qT resummation at N 3LL accuracy and fiducial cross sections at N 3LO, arXiv:2103.04974

  30. [35]

    X. Chen, T. Gehrmann, E. W. N. Glover, A. Huss, P. F. Monni, E. Re, L. Rottoli, and P. Torrielli, Third-Order Fiducial Predictions for Drell-Yan Production at the LHC , Phys. Rev. Lett. 128 (2022), no. 25 252001, [ arXiv:2203.01565]

  31. [36]

    Neumann and J

    T. Neumann and J. Campbell, Fiducial Drell-Yan production at the LHC improved by transverse-momentum resummation at N4LLp+N3LO , Phys. Rev. D 107 (2023), no. 1 L011506, [arXiv:2207.07056]

  32. [37]

    Campbell and T

    J. Campbell and T. Neumann, Third order QCD predictions for fiducial W-boson production, JHEP 11 (2023) 127, [ arXiv:2308.15382]

  33. [38]

    de Florian, M

    D. de Florian, M. Der, and I. Fabre, QCD⊕QED NNLO corrections to Drell Yan production, Phys. Rev. D 98 (2018), no. 9 094008, [ arXiv:1805.12214]

  34. [39]

    Cieri, D

    L. Cieri, D. de Florian, M. Der, and J. Mazzitelli, Mixed QCD⊗QED corrections to exclusive Drell Yan production using the q T -subtraction method, JHEP 09 (2020) 155, [arXiv:2005.01315]

  35. [40]

    Delto, M

    M. Delto, M. Jaquier, K. Melnikov, and R. R¨ ontsch, Mixed QCD⊗QED corrections to on-shell Z boson production at the LHC , JHEP 01 (2020) 043, [ arXiv:1909.08428]

  36. [41]

    Bonciani, F

    R. Bonciani, F. Buccioni, R. Mondini, and A. Vicini, Double-real corrections at O(ααs) to single gauge boson production , Eur. Phys. J. C 77 (2017), no. 3 187, [arXiv:1611.00645]. 21

  37. [42]

    Bonciani, F

    R. Bonciani, F. Buccioni, N. Rana, I. Triscari, and A. Vicini, NNLO QCD ×EW corrections to Z production in the q ¯q channel, Phys. Rev. D 101 (2020), no. 3 031301, [arXiv:1911.06200]

  38. [43]

    Bonciani, F

    R. Bonciani, F. Buccioni, N. Rana, and A. Vicini, NNLO QCD ×EW corrections to on-shell Z production, Phys. Rev. Lett. 125 (2020), no. 23 232004, [ arXiv:2007.06518]

  39. [44]

    Buccioni, F

    F. Buccioni, F. Caola, M. Delto, M. Jaquier, K. Melnikov, and R. R¨ ontsch, Mixed QCD-electroweak corrections to on-shell Z production at the LHC , Phys. Lett. B 811 (2020) 135969, [ arXiv:2005.10221]

  40. [45]

    Behring, F

    A. Behring, F. Buccioni, F. Caola, M. Delto, M. Jaquier, K. Melnikov, and R. R¨ ontsch, Mixed QCD-electroweak corrections to W -boson production in hadron collisions , Phys. Rev. D 103 (2021), no. 1 013008, [ arXiv:2009.10386]

  41. [46]

    Bonciani, F

    R. Bonciani, F. Buccioni, N. Rana, and A. Vicini, On-shell Z boson production at hadron colliders through O(ααs), JHEP 02 (2022) 095, [ arXiv:2111.12694]

  42. [47]

    Denner and S

    A. Denner and S. Dittmaier, Electroweak Radiative Corrections for Collider Physics , Phys. Rept. 864 (2020) 1–163, [ arXiv:1912.06823]

  43. [48]

    Dittmaier, A

    S. Dittmaier, A. Huss, and C. Schwinn, Mixed QCD-electroweak O(αsα) corrections to Drell-Yan processes in the resonance region: pole approximation and non-factorizable corrections, Nucl. Phys. B 885 (2014) 318–372, [ arXiv:1403.3216]

  44. [49]

    Dittmaier, A

    S. Dittmaier, A. Huss, and C. Schwinn, Dominant mixed QCD-electroweak O( αsα) corrections to Drell–Yan processes in the resonance region , Nucl. Phys. B 904 (2016) 216–252, [arXiv:1511.08016]

  45. [50]

    Dittmaier, A

    S. Dittmaier, A. Huss, and J. Schwarz, Mixed NNLO QCD × electroweak corrections to single-Z production in pole approximation: differential distributions and forward-backward asymmetry, JHEP 05 (2024) 170, [ arXiv:2401.15682]

  46. [51]

    Dittmaier, T

    S. Dittmaier, T. Schmidt, and J. Schwarz, Mixed NNLO QCD ×electroweak corrections of O(Nf αsα) to single-W/Z production at the LHC , JHEP 12 (2020) 201, [arXiv:2009.02229]

  47. [52]

    Buonocore, M

    L. Buonocore, M. Grazzini, S. Kallweit, C. Savoini, and F. Tramontano, Mixed QCD-EW corrections to pp → ℓνℓ+X at the LHC , Phys. Rev. D 103 (2021) 114012, [arXiv:2102.12539]

  48. [53]

    Armadillo, R

    T. Armadillo, R. Bonciani, S. Devoto, N. Rana, and A. Vicini, Two-loop mixed QCD-EW corrections to charged current Drell-Yan , JHEP 07 (2024) 265, [arXiv:2405.00612]

  49. [57]

    Bonciani, S

    R. Bonciani, S. Di Vita, P. Mastrolia, and U. Schubert, Two-Loop Master Integrals for the mixed EW-QCD virtual corrections to Drell-Yan scattering , JHEP 09 (2016) 091, [arXiv:1604.08581]

  50. [58]

    Moriello, Generalised power series expansions for the elliptic planar families of Higgs + jet production at two loops , JHEP 01 (2020) 150, [ arXiv:1907.13234]

    F. Moriello, Generalised power series expansions for the elliptic planar families of Higgs + jet production at two loops , JHEP 01 (2020) 150, [ arXiv:1907.13234]

  51. [59]

    Hidding, DiffExp, a Mathematica package for computing Feynman integrals in terms of one-dimensional series expansions , Comput

    M. Hidding, DiffExp, a Mathematica package for computing Feynman integrals in terms of one-dimensional series expansions , Comput. Phys. Commun. 269 (2021) 108125, [arXiv:2006.05510]

  52. [60]

    Armadillo, R

    T. Armadillo, R. Bonciani, S. Devoto, N. Rana, and A. Vicini, Evaluation of Feynman integrals with arbitrary complex masses via series expansions , Comput. Phys. Commun. 282 (2023) 108545, [ arXiv:2205.03345]

  53. [61]

    Heller, A

    M. Heller, A. von Manteuffel, R. M. Schabinger, and H. Spiesberger, Mixed EW-QCD two-loop amplitudes for q ¯q → ℓ+ℓ− and γ5 scheme independence of multi-loop corrections, JHEP 05 (2021) 213, [ arXiv:2012.05918]

  54. [62]

    Heller, A

    M. Heller, A. von Manteuffel, and R. M. Schabinger, Multiple polylogarithms with algebraic arguments and the two-loop EW-QCD Drell-Yan master integrals , Phys. Rev. D 102 (2020), no. 1 016025, [ arXiv:1907.00491]

  55. [63]

    S. M. Hasan and U. Schubert, Master Integrals for the mixed QCD-QED corrections to the Drell-Yan production of a massive lepton pair , JHEP 11 (2020) 107, [arXiv:2004.14908]

  56. [64]

    Balossini, G

    G. Balossini, G. Montagna, C. M. Carloni Calame, M. Moretti, M. Treccani, O. Nicrosini, F. Piccinini, and A. Vicini, Electroweak & QCD corrections to Drell Yan processes, Acta Phys. Polon. B 39 (2008) 1675, [ arXiv:0805.1129]

  57. [65]

    Balossini, G

    G. Balossini, G. Montagna, C. M. Carloni Calame, M. Moretti, O. Nicrosini, F. Piccinini, M. Treccani, and A. Vicini, Combination of electroweak and QCD corrections to single W production at the Fermilab Tevatron and the CERN LHC , JHEP 01 (2010) 013, [ arXiv:0907.0276]

  58. [66]

    Grazzini, S

    M. Grazzini, S. Kallweit, J. M. Lindert, S. Pozzorini, and M. Wiesemann, NNLO QCD + NLO EW with Matrix+OpenLoops: precise predictions for vector-boson pair production, JHEP 02 (2020) 087, [ arXiv:1912.00068]. 23

  59. [67]

    de Florian, G

    D. de Florian, G. F. R. Sborlini, and G. Rodrigo, QED corrections to the Altarelli–Parisi splitting functions , Eur. Phys. J. C 76 (2016), no. 5 282, [ arXiv:1512.00612]

  60. [68]

    de Florian, G

    D. de Florian, G. F. R. Sborlini, and G. Rodrigo, Two-loop QED corrections to the Altarelli-Parisi splitting functions , JHEP 10 (2016) 056, [ arXiv:1606.02887]

  61. [69]

    CTEQ-TEA Collaboration, K. Xie, T. J. Hobbs, T.-J. Hou, C. Schmidt, M. Yan, and C. P. Yuan, Photon PDF within the CT18 global analysis , Phys. Rev. D 105 (2022), no. 5 054006, [ arXiv:2106.10299]

  62. [70]

    Cridge, L

    T. Cridge, L. A. Harland-Lang, and R. S. Thorne, Combining QED and Approximate N3LO QCD Corrections in a Global PDF Fit: MSHT20qed an3lo PDFs , arXiv:2312.07665

  63. [71]

    Barontini, N

    A. Barontini, N. Laurenti, and J. Rojo, NNPDF4.0 aN 3LO PDFs with QED corrections , in 31st International Workshop on Deep-Inelastic Scattering and Related Subjects , 6,

  64. [72]

    M. L. Mangano et al., Physics at a 100 TeV pp Collider: Standard Model Processes , arXiv:1607.01831

  65. [73]

    Manohar, P

    A. Manohar, P. Nason, G. P. Salam, and G. Zanderighi, How bright is the proton? A precise determination of the photon parton distribution function , Phys. Rev. Lett. 117 (2016), no. 24 242002, [ arXiv:1607.04266]

  66. [74]

    A. V. Manohar, P. Nason, G. P. Salam, and G. Zanderighi, The Photon Content of the Proton, JHEP 12 (2017) 046, [ arXiv:1708.01256]

  67. [75]

    R. D. Ball, A. Candido, S. Forte, F. Hekhorn, E. R. Nocera, J. Rojo, and C. Schwan, Parton distributions and new physics searches: the Drell–Yan forward–backward asymmetry as a case study , Eur. Phys. J. C 82 (2022), no. 12 1160, [arXiv:2209.08115]

  68. [76]

    Barze, G

    L. Barze, G. Montagna, P. Nason, O. Nicrosini, F. Piccinini, and A. Vicini, Neutral current Drell-Yan with combined QCD and electroweak corrections in the POWHEG BOX, Eur. Phys. J. C 73 (2013), no. 6 2474, [ arXiv:1302.4606]

  69. [77]

    Kallweit, J

    S. Kallweit, J. M. Lindert, P. Maierh¨ ofer, S. Pozzorini, and M. Sch¨ onherr,NLO QCD+EW predictions for V + jets including off-shell vector-boson decays and multijet merging, JHEP 04 (2016) 021, [ arXiv:1511.08692]

  70. [78]

    J. R. Andersen et al., Les Houches 2015: Physics at TeV Colliders Standard Model Working Group Report, in 9th Les Houches Workshop on Physics at TeV Colliders , 5,

  71. [79]

    Alioli et al., Precision studies of observables in pp → W → lνl and pp → γ, Z→ l+l− processes at the LHC , Eur

    S. Alioli et al., Precision studies of observables in pp → W → lνl and pp → γ, Z→ l+l− processes at the LHC , Eur. Phys. J. C 77 (2017), no. 5 280, [ arXiv:1606.02330]. 24

  72. [80]

    Cascioli, P

    F. Cascioli, P. Maierh¨ ofer, and S. Pozzorini,Scattering Amplitudes with Open Loops , Phys. Rev. Lett. 108 (2012) 111601, [ arXiv:1111.5206]

  73. [81]

    Buccioni, S

    F. Buccioni, S. Pozzorini, and M. Zoller, On-the-fly reduction of open loops , Eur. Phys. J. C 78 (2018), no. 1 70, [ arXiv:1710.11452]

  74. [82]

    Buccioni, J.-N

    F. Buccioni, J.-N. Lang, J. M. Lindert, P. Maierh¨ ofer, S. Pozzorini, H. Zhang, and M. F. Zoller, OpenLoops 2, Eur. Phys. J. C 79 (2019), no. 10 866, [ arXiv:1907.13071]

  75. [83]

    Actis, A

    S. Actis, A. Denner, L. Hofer, J.-N. Lang, A. Scharf, and S. Uccirati, RECOLA: REcursive Computation of One-Loop Amplitudes , Comput. Phys. Commun. 214 (2017) 140–173, [arXiv:1605.01090]

  76. [84]

    Denner, J.-N

    A. Denner, J.-N. Lang, and S. Uccirati, Recola2: REcursive Computation of One-Loop Amplitudes 2, Comput. Phys. Commun. 224 (2018) 346–361, [ arXiv:1711.07388]

  77. [85]

    Denner, S

    A. Denner, S. Dittmaier, and L. Hofer, Collier: a fortran-based Complex One-Loop LIbrary in Extended Regularizations , Comput. Phys. Commun. 212 (2017) 220–238, [arXiv:1604.06792]

  78. [86]

    Maierh¨ ofer, J

    P. Maierh¨ ofer, J. Usovitsch, and P. Uwer,Kira—A Feynman integral reduction program, Comput. Phys. Commun. 230 (2018) 99–112, [ arXiv:1705.05610]

  79. [87]

    Denner, S

    A. Denner, S. Dittmaier, M. Roth, and L. H. Wieders, Electroweak corrections to charged-current e+ e- — > 4 fermion processes: Technical details and further results , Nucl. Phys. B 724 (2005) 247–294, [ hep-ph/0505042]. [Erratum: Nucl.Phys.B 854, 504–507 (2012)]

  80. [88]

    Catani and M

    S. Catani and M. Grazzini, An NNLO subtraction formalism in hadron collisions and its application to Higgs boson production at the LHC , Phys. Rev. Lett. 98 (2007) 222002, [hep-ph/0703012]

  81. [89]

    Catani, S

    S. Catani, S. Devoto, M. Grazzini, S. Kallweit, J. Mazzitelli, and H. Sargsyan, Top-quark pair hadroproduction at next-to-next-to-leading order in QCD , Phys. Rev. D 99 (2019), no. 5 051501, [ arXiv:1901.04005]

  82. [90]

    Catani, S

    S. Catani, S. Devoto, M. Grazzini, S. Kallweit, and J. Mazzitelli, Top-quark pair production at the LHC: Fully differential QCD predictions at NNLO , JHEP 07 (2019) 100, [arXiv:1906.06535]

  83. [91]

    Catani, S

    S. Catani, S. Devoto, M. Grazzini, S. Kallweit, and J. Mazzitelli, Bottom-quark production at hadron colliders: fully differential predictions in NNLO QCD , JHEP 03 (2021) 029, [ arXiv:2010.11906]

  84. [92]

    Buonocore, M

    L. Buonocore, M. Grazzini, and F. Tramontano, The qT subtraction method: electroweak corrections and power suppressed contributions, Eur. Phys. J. C 80 (2020), no. 3 254, [arXiv:1911.10166]. 25

  85. [93]

    Catani and M

    S. Catani and M. H. Seymour, The Dipole formalism for the calculation of QCD jet cross-sections at next-to-leading order , Phys. Lett. B 378 (1996) 287–301, [hep-ph/9602277]

  86. [94]

    Catani and M

    S. Catani and M. H. Seymour, A General algorithm for calculating jet cross-sections in NLO QCD , Nucl. Phys. B 485 (1997) 291–419, [ hep-ph/9605323]. [Erratum: Nucl.Phys.B 510, 503–504 (1998)]

  87. [95]

    Catani, S

    S. Catani, S. Dittmaier, M. H. Seymour, and Z. Trocsanyi, The Dipole formalism for next-to-leading order QCD calculations with massive partons , Nucl. Phys. B 627 (2002) 189–265, [hep-ph/0201036]

  88. [96]

    Kallweit, J

    S. Kallweit, J. M. Lindert, S. Pozzorini, and M. Sch¨ onherr, NLO QCD+EW predictions for 2ℓ2ν diboson signatures at the LHC , JHEP 11 (2017) 120, [ arXiv:1705.00598]

  89. [97]

    Dittmaier, A General approach to photon radiation off fermions , Nucl

    S. Dittmaier, A General approach to photon radiation off fermions , Nucl. Phys. B 565 (2000) 69–122, [ hep-ph/9904440]

  90. [98]

    Dittmaier, A

    S. Dittmaier, A. Kabelschacht, and T. Kasprzik, Polarized QED splittings of massive fermions and dipole subtraction for non-collinear-safe observables , Nucl. Phys. B 800 (2008) 146–189, [ arXiv:0802.1405]

  91. [99]

    Gehrmann and N

    T. Gehrmann and N. Greiner, Photon Radiation with MadDipole , JHEP 12 (2010) 050, [arXiv:1011.0321]

  92. [100]

    Sch¨ onherr,An automated subtraction of NLO EW infrared divergences , Eur

    M. Sch¨ onherr,An automated subtraction of NLO EW infrared divergences , Eur. Phys. J. C 78 (2018), no. 2 119, [ arXiv:1712.07975]

  93. [101]

    Grazzini, S

    M. Grazzini, S. Kallweit, and M. Wiesemann, Fully differential NNLO computations with MATRIX, Eur. Phys. J. C 78 (2018), no. 7 537, [ arXiv:1711.06631]

  94. [102]

    Catani, S

    S. Catani, S. Devoto, M. Grazzini, S. Kallweit, J. Mazzitelli, and C. Savoini, Higgs Boson Production in Association with a Top-Antitop Quark Pair in Next-to-Next-to-Leading Order QCD, Phys. Rev. Lett. 130 (2023), no. 11 111902, [arXiv:2210.07846]

  95. [103]

    Buonocore, S

    L. Buonocore, S. Devoto, S. Kallweit, J. Mazzitelli, L. Rottoli, and C. Savoini, Associated production of a W boson and massive bottom quarks at next-to-next-to-leading order in QCD , Phys. Rev. D 107 (2023), no. 7 074032, [arXiv:2212.04954]

  96. [104]

    Buonocore, S

    L. Buonocore, S. Devoto, M. Grazzini, S. Kallweit, J. Mazzitelli, L. Rottoli, and C. Savoini, Precise Predictions for the Associated Production of a W Boson with a Top-Antitop Quark Pair at the LHC , Phys. Rev. Lett. 131 (2023), no. 23 231901, [arXiv:2306.16311]. 26

  97. [105]

    Devoto, M

    S. Devoto, M. Grazzini, S. Kallweit, J. Mazzitelli, and C. Savoini, Precise predictions for t¯tH production at the LHC: inclusive cross section and differential distributions , arXiv:2411.15340

  98. [106]

    Catani, S

    S. Catani, S. Devoto, M. Grazzini, and J. Mazzitelli, Soft-parton contributions to heavy-quark production at low transverse momentum , JHEP 04 (2023) 144, [arXiv:2301.11786]

  99. [107]

    Bertone, S

    NNPDF Collaboration, V. Bertone, S. Carrazza, N. P. Hartland, and J. Rojo, Illuminating the photon content of the proton within a global PDF analysis , SciPost Phys. 5 (2018), no. 1 008, [ arXiv:1712.07053]

  100. [108]

    G. P. Salam and E. Slade, Cuts for two-body decays at colliders , JHEP 11 (2021) 220, [arXiv:2106.08329]

  101. [109]

    NNPDF Collaboration, R. D. Ball et al., Determination of the theory uncertainties from missing higher orders on NNLO parton distributions with percent accuracy , Eur. Phys. J. C 84 (2024), no. 5 517, [ arXiv:2401.10319]

  102. [110]

    J. C. Collins and D. E. Soper, Angular Distribution of Dileptons in High-Energy Hadron Collisions, Phys. Rev. D 16 (1977) 2219

  103. [111]

    CMS Collaboration, A. M. Sirunyan et al., Search for resonant and nonresonant new phenomena in high-mass dilepton final states at √s = 13 TeV , JHEP 07 (2021) 208, [arXiv:2103.02708]

  104. [112]

    Hammou, Z

    E. Hammou, Z. Kassabov, M. Madigan, M. L. Mangano, L. Mantani, J. Moore, M. M. Alvarado, and M. Ubiali, Hide and seek: how PDFs can conceal new physics , JHEP 11 (2023) 090, [ arXiv:2307.10370]

  105. [113]

    Amoroso, M

    S. Amoroso, M. Chiesa, C. L. Del Pio, K. Lipka, F. Piccinini, F. Vazzoler, and A. Vicini, Probing the weak mixing angle at high energies at the LHC and HL-LHC , Phys. Lett. B 844 (2023) 138103, [ arXiv:2302.10782]

  106. [114]

    U. Baur, S. Keller, and W. K. Sakumoto, QED radiative corrections to Z boson production and the forward backward asymmetry at hadron colliders , Phys. Rev. D 57 (1998) 199–215, [ hep-ph/9707301]

  107. [115]

    Schael et al., Precision electroweak measurements on the Z resonance, Phys

    ALEPH, DELPHI, L3, OPAL, SLD, LEP Electroweak Working Group, SLD Electroweak Group, SLD Heavy Flavour GroupCollaboration, S. Schael et al., Precision electroweak measurements on the Z resonance, Phys. Rept. 427 (2006) 257–454, [hep-ex/0509008]

  108. [116]

    CMS Collaboration, A. M. Sirunyan et al., Measurement of the weak mixing angle using the forward-backward asymmetry of Drell-Yan events in pp collisions at 8 TeV , Eur. Phys. J. C 78 (2018), no. 9 701, [ arXiv:1806.00863]. 27

  109. [117]

    ATLAS Collaboration, G. Aad et al., Measurement of the forward-backward asymmetry of electron and muon pair-production in pp collisions at √s = 7 TeV with the ATLAS detector, JHEP 09 (2015) 049, [ arXiv:1503.03709]

  110. [118]

    Chiesa, F

    M. Chiesa, F. Piccinini, and A. Vicini, Direct determination of sin2 θℓ ef fat hadron colliders, Phys. Rev. D 100 (2019), no. 7 071302, [ arXiv:1906.11569]

  111. [119]

    Navas et al., Review of particle physics , Phys

    Particle Data GroupCollaboration, S. Navas et al., Review of particle physics , Phys. Rev. D 110 (2024), no. 3 030001

  112. [120]

    Cacciari, M

    M. Cacciari, M. Greco, and P. Nason, The P(T) spectrum in heavy flavor hadroproduction, JHEP 05 (1998) 007, [ hep-ph/9803400]

  113. [121]

    J. C. Collins and W.-K. Tung, Calculating Heavy Quark Distributions , Nucl. Phys. B 278 (1986) 934. 28

Pith tools

Reviewed August 11, 2026 · model on record in the stance chip above.