Pith. sign in

REVIEW 5 major objections 5 minor 88 references

Two-gap superconductor ZrB$_{12}$ with dynamic stripes and charge density waves: Crystal structure, physical properties and pairing mechanism

T0 review · 5 major / 5 minor · reviewed 2026-08-07 · deepseek-v4-flash

Pith's one-line read ZrB12's two-gap superconductivity is driven by a composite plasmon-phonon mechanism: quasi-local Zr-ion phonons synchronized by high-frequency Jahn-Teller vibrations of the boron cages.

desk verdict A data-rich dodecaboride paper whose new measurements look solid, but whose central plasmon-phonon pairing mechanism is an asserted sketch, not a derived result. read the letter →

arxiv 2505.23424 v1 pith:W5DRSDRU submitted 2025-05-29 cond-mat.supr-con

classification cond-mat.supr-con
keywords dynamicchargestripesdensitywavestwo-gapsuperconductivityZrB12LudodecaboridesJahn-Tellereffectplasmon-phononpairing
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

This paper asks why ZrB12, a dodecaboride with nearly the same conduction bands and phonon spectra as LuB12, superconducts at $T_c \approx 6$ K while LuB12 sits at $\approx 0.4$ K. It argues that the answer lies in nanoscale electron phase separation: in ZrB12, Jahn-Teller instability of the rigid boron framework creates dynamic charge stripes made predominantly of boron $2p$ states, forming two interpenetrating checkerboard grids, plus a sub-structural charge density wave. These stripes synchronize quasi-local vibrations of Zr ions into pairs, and the attraction between electrons in those pairs is mediated by both Zr-ion phonons and high-frequency collective Jahn-Teller vibrations (plasmons) of the boron cages. The resulting composite plasmon-phonon mechanism, the paper claims, produces two-gap superconductivity in ZrB12 and may be common to other high-$T_c$ families. If correct, it turns a supposedly conventional superconductor into a testbed for pairing physics usually reserved for cuprates and hydrides.

What carries the argument

The load-bearing evidence is the electron-density distribution obtained by the maximum entropy method (MEM) from X-ray diffraction data, which shows two ordered charge patterns in ZrB12 at low temperature: a triangular lattice of s-CDW antinodes in $\{111\}$ interstices and three-dimensional grids of dynamic charge stripes along $\langle 110\rangle$ built from $2p$ states of the boron sublattice. On these patterns, the paper constructs the mechanism: vibrationally coupled Zr-Zr pairs transverse to the stripes, with quasi-local Einstein modes near 17.5 meV synchronized by the collective Jahn-Teller mode of the boron cage (above 50 meV), giving a composite plasmon-phonon pairing.

What would settle it

A high-resolution X-ray diffuse scattering or pair-distribution-function study of ZrB12 that shows the $\langle 110\rangle$ electron-density filaments to be static displacements or truncation artifacts, rather than temperature-dependent dynamic fluctuations, would falsify the proposed pairing mechanism.

Watch

Extended reading notes

Core claim

On the paper's own terms, the central discovery is that the electron density in ZrB12, mapped by the maximum entropy method from X-ray diffraction data, is organized into dynamic charge stripes along $\langle 110\rangle$ directions of the boron sublattice and a triangular lattice of sub-structural charge density wave antinodes in the $\{111\}$ interstices. These patterns are absent or different in LuB12, where the stripes are linear and involve mixed $5d$-$2p$ states. The paper proposes that the attraction between two electrons in a Zr-Zr pair is mediated by quasi-local oscillations of Zr ions (Einstein phonons near 17.5 meV) together with high-frequency collective Jahn-Teller vibrations of the B12 cages (plasmons, above 50 meV), synchronized by the quasi-one-dimensional collective dynamics of boron chains. This composite plasmon-phonon pairing, with two quasi-local Zr vibrations separated by the superconducting coherence length of about 570 Å, is offered as the mechanism behind the two-gap superconductivity of ZrB12 and as a scenario that may extend to other classes of high-$T_c$ superconductors.

Load-bearing premise

The claim rests on the assumption that the electron-density filaments seen in maximum-entropy maps of X-ray diffraction data are real, dynamically fluctuating charge stripes and a sub-structural charge density wave, not artifacts of Fourier truncation, static atomic displacements, or the structural model chosen.

Editorial extensions

If this is right

  • If the mechanism is right, the 15-fold gap in $T_c$ between ZrB12 and LuB12 is explained by stripe topology: only ZrB12's $2p$ stripe grids allow synchronized transverse Zr pairs, whereas LuB12's linear $5d$-$2p$ stripes do not.
  • The two phase transitions at $T_0 \approx 42$ K and $T \approx \Theta_E \approx 180$ K acquire a concrete role: changes in configuration and pinning of sliding CDWs, with the CDW gap widening from 42 to 52 K in a 90 kOe field.
  • The paper's estimate of very short electron-phonon relaxation times ($10^{13}$-$10^{14}$ s$^{-1}$) and strongly non-equilibrium many-body states above $T_c$ would characterize the normal state of ZrB12 as a fluctuating, stripe-ordered metal rather than a simple Fermi liquid.
  • If transferable, the same composite pairing could apply to hydride superconductors like (La,Y)H$_n$ and to cuprates with collective oxygen-octahedra dynamics, as the authors explicitly propose.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Editor's inference: the mechanism makes a sharp, testable prediction that boron isotope substitution should alter $T_c$ through the Jahn-Teller mode frequency; isotope work cited in the paper focused on phonon renormalization, not on this specific pairing prediction.
  • Editor's inference: the MEM charge patterns should be corroborated by momentum-resolved diffuse scattering; if the $\langle 110\rangle$ filaments appear as broad dynamic diffuse streaks that sharpen or weaken with temperature, that would independently confirm dynamic stripes.
  • Editor's inference: the analogy with Little's excitonic model suggests a quantitative calculation: a one-dimensional chain with side-chain charge oscillators at the Jahn-Teller frequency should produce an enhanced effective attraction, and such a model could be simulated to see whether the predicted pairing strength matches the observed two gaps.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

5 major / 5 minor

Summary. The manuscript combines a review of previous work on the dodecaboride superconductors ZrB12 and LuB12 with new experimental data on crystal structure, resistivity, Seebeck coefficient, thermal conductivity, heat capacity, Hall effect, and magnetoresistance of ZrB12. From maximum-entropy (MEM) electron-density maps, the authors identify dynamic charge stripes and a sub-structural charge density wave (s-CDW) in ZrB12, and they propose a composite plasmon-phonon pairing mechanism in which quasi-local Zr-ion Einstein phonons synchronized by high-frequency collective Jahn-Teller vibrations of the B12 cages mediate attraction between electrons in Zr-Zr pairs. The paper also attributes anomalies near T0≈42 K and ΘE≈180 K in heat capacity, thermal conductivity, and Hall coefficient to transitions of the s-CDW state. The central claim is that this new mechanism, rather than ordinary electron-phonon coupling, drives the two-gap superconductivity of ZrB12.

Significance. If the proposed plasmon-phonon mechanism were quantitatively established, it would be a significant contribution to the physics of boride superconductors and potentially relevant to other classes of high-Tc materials. The manuscript's strengths are the breadth and internal consistency of the new transport, thermodynamic, and structural data, especially the wide-temperature range of the measurements and the comparative analysis of ZrB12 and LuB12. The MEM maps provide a useful visualization of residual electron density in the interstices. However, the central claim is not derived or quantitatively supported: no Hamiltonian, coupling constant, or calculated Tc is given, the dynamic interpretation of the MEM maps is not independently tested, the high-frequency JT mode in ZrB12 is not measured, and the assignment of T0 as a CDW gap rests on a fitted parameter reused to interpret other data. The manuscript is therefore better viewed as a data-rich speculative synthesis than as a demonstration of the proposed pairing mechanism.

major comments (5)
  1. [III.1, III.2, and Discussion] The parameter T0≈42 K is obtained by fitting the Seebeck coefficient and resistivity to Eqs. (1b) and (2b), and it is then reused in Sections III.3-III.5 and in the Discussion as the CDW gap that explains anomalies in heat capacity, thermal conductivity, and Hall coefficient. This is circular: the 'predictions' are restatements of the same fitted value, not independent tests. An independent determination of the CDW gap, for example from X-ray diffuse scattering, tunneling spectroscopy, or optical conductivity of ZrB12, is needed to support the claim that T0 is the CDW gap.
  2. [II, Figs. 5-7] The interpretation of the MEM maps as dynamic charge stripes and an s-CDW is not adequately supported. MEM maps are time- and space-averaged electron densities; they cannot establish that the features fluctuate dynamically, nor can they determine the frequency of any such fluctuations. The paper does not provide control refinements (e.g., anharmonic atomic displacement models or split positions for Zr) to rule out static disorder or Fourier-truncation artifacts. Since the proposed pairing mechanism depends on the reality and dynamical character of these stripes, this is a load-bearing gap in the evidence.
  3. [Discussion and Conclusions] The proposed composite plasmon-phonon mechanism requires a high-frequency collective Jahn-Teller mode of the boron cages in ZrB12 with ħω_JT > 50 meV that mediates electron-electron attraction. The only cited observation of such a collective mode is in LuB12 (ref. 76); no optical, inelastic neutron scattering, or other measurement for ZrB12 is presented to show that this mode exists in ZrB12 or that it couples to conduction electrons. Moreover, the paper provides no Hamiltonian, no coupling constant, and no estimate of Tc from the proposed mechanism, so the statement that 'the attraction between electrons located in Zr-Zr pairs are mediated by both ...' is an assertion rather than a derived result.
  4. [III.4, Fig. 11] The identification of the two maxima in ΔC(T)=C−CD−CE−γT near T0 and ΘE as hidden phase transitions is not sufficiently justified. The subtraction relies on fitted values of ΘD, ΘE, and γ, and the residual maxima could arise from oversubtraction of the Debye and Einstein contributions or from anharmonicity of the low-energy Einstein mode. Without a model for the expected CDW heat-capacity contribution, these features do not by themselves demonstrate phase transitions, and the connection to the s-CDW states is speculative.
  5. [Discussion, Little analogy] The analogy to Little's excitonic pairing model (ref. 77) is invoked without quantitative justification. The manuscript does not show that the geometry of the dynamic stripes and Zr-Zr pairs satisfies the conditions for excitonic or plasmon-mediated pairing, nor does it estimate the effective coupling strength or the resulting Tc. This leaves the central mechanism at the level of a plausible narrative rather than a testable theory.
minor comments (5)
  1. [Throughout] The manuscript alternates between a review of prior work and a report of new measurements; the roles of these parts should be clarified, and the new results should be clearly distinguished from previously published data.
  2. [III.2, Fig. 9b] The caption and legend for the two fits of ZrB12 by Eq. (2b) should state the fitted values of S0 and T0 for H=0 and H=90 kOe explicitly, since the text refers to the same S0 but the figure does not show these parameters.
  3. [III.1, Fig. 9a] The text states that ZrB12 shows a Fermi-liquid Δρ~T2 behavior below T0, but the corresponding fit is not shown as a distinct curve in Fig. 9a; please identify the temperature range of this fit and the fitted coefficient.
  4. [III.6, Fig. 16] The caption of Fig. 16b refers to a blue solid circle corresponding to an estimation from quantum oscillations, but the legend does not identify the symbol or the source; please clarify the symbol and cite the reference in the caption.
  5. [Introduction] There are typographical inconsistencies in author names and symbols (e.g., 'Teissier' should be 'Teyssier', and several equations have garbled Greek letters); these should be corrected in proof.

Circularity Check

2 steps flagged · score 6.0 of 10

T0 is fitted to transport data and relabeled as the CDW gap, and the >50 meV JT mode of ZrB12 is imported from the authors' LuB12 self-citation, making the composite pairing mechanism partially circular.

  1. fitted input called prediction [Sec. III.1 Eq. (1b), Sec. III.2 Eq. (2b), Sec. III.3, Sec. III.4, Sec. III.5]
    "for ZrB12 the step-like singularity of Seebeck coefficient is well described by relation S(T)=S0 e−T0/T (2b) with the same value T0≈42 K ... We propose that the parameter T0 in Eq. (2b) corresponds to the CDW gap value Δ0≈42 K ... there are three distinct features of heat capacity detected here, including ... (ii) a knee with strong instability of dC/dT(T) near T0~42 K ... The last two singularities at T0 and ΘE correlate very well with the transitions in the s-CDW state in ZrB12."

    T0 is obtained by fitting the same ZrB12 transport data: Eq. (1b) fits Δρ(T) and Eq. (2b) fits S(T), giving T0≈42 K. The paper then labels this fitted T0 as the s-CDW gap Δ0 and uses the same number to identify 'singularities' and 'phase transitions' at T0≈42 K in thermal conductivity, heat capacity, and Hall coefficient (Secs. III.3–III.5 and Conclusions). Because those identifications presuppose the fitted T0, they are not independent confirmations; the 'predicted' anomalies at 42 K are in effect read from the same parameter that was inserted into the analysis. The heat-capacity feature is extracted after subtracting fixed CD, CE, and γT contributions, so the residual maxima at T0 are not a free prediction.

  2. ansatz smuggled in via citation [Discussion (Fig. 15 discussion), Conclusions; ref. [76]]
    "In contrast, the network of 2p-type stripes is observed in ZrB12 (Fig. 6), oscillating with the frequency of Jahn-Teller collective mode of the rigid boron cage (ħωJT > 50 meV, [76]). The JT mode induces the transverse to stripe quasi-local vibrations of Zr4+ ions in pairs, and these Einstein phonons, which mediate the superconductivity in ZrB12, turn out to be synchronized by the quasi-1D collective dynamics of the boron chains."

    The only citation for the >50 meV JT collective mode is [76], the authors' own infrared study of LuB12; the same Discussion states that 'the collective excitation was detected in the far infrared optical conductivity spectra of LuB12 [76]'. No infrared, Raman, neutron, or tunneling data on ZrB12 are presented to establish ħωJT>50 meV in ZrB12. The composite plasmon-phonon mechanism nevertheless assumes this unmeasured ZrB12 mode synchronizes the Zr-ion Einstein phonons and mediates the electron attraction. The load-bearing input is therefore an ansatz imported from a self-citation about a different compound, rather than a result derived in this paper.

full rationale

The T0 step is a genuine reduction: Eq. (1b) and Eq. (2b) both fit T0≈42 K to the same ZrB12 resistivity and Seebeck data, and the paper then calls this number the CDW gap and uses it to label anomalies in κ, C, and RH as transitions. Those anomalies are not independent tests because the same fitted value is inserted into the analysis; the heat-capacity residual ΔC is computed with fixed ΘE and γ and then read out at the pre-assigned T0. The second circular step is the load-bearing use of ref. [76]: the only cited basis for the required ħωJT>50 meV collective JT mode in ZrB12 is the authors' own infrared observation in LuB12, and no ZrB12 optical or scattering data for this mode are presented. The MEM maps in Figs. 5–7 are time- and space-averaged and cannot by themselves establish that the stripes are dynamic at ħωJT>50 meV; that is an evidentiary gap rather than a definitional circularity, but it reinforces why the JT-mode step reduces to a self-citation. The two-gap superconductivity and coherence length are taken from prior independent measurements (e.g., refs. [48–50]) and are not circular in themselves. Score 6 reflects partial circularity: the T0 identification is fitted-input-called-prediction, and the central mechanism borrows its required boson from a self-cited LuB12 result.

Assumptions & free parameters 4 free parameters · 5 assumptions · 3 invented entities

The central claim rests on interpreting MEM maps as dynamic stripes and s-CDW, on prior characterization of ZrB12 as a two-gap dirty-limit superconductor, and on the unsupported identification of the collective JT mode as a pairing plasmon.

free parameters (4)
  • T0 (CDW gap parameter) = 42 K at H=0, 52 K at H=90 kOe
    Extracted from exponential fits to Seebeck and resistivity (Eq. 2b), then assigned as the s-CDW gap and used to explain heat capacity, thermal conductivity, and Hall anomalies.
  • Theta_E (Einstein temperature) = 182 K from ADP, 195 K from heat capacity
    Used to separate Einstein/Debye contributions to heat capacity and to identify the Theta_E phase transition in DeltaC(T).
  • Theta_D (Debye temperature) = 1260 K at low T, 1080 K above 100 K
    Used in the heat capacity decomposition CD(T) that yields the residual DeltaC(T) maxima interpreted as phase transitions.
  • Gamma (Sommerfeld coefficient) = 4.6 mJ/(mol K2)
    Used in DeltaC(T)=C-CD-CE-GammaT; a different Gamma would shift the residual maxima used as evidence for phase transitions.
assumptions (5)
  • domain assumption B12 cuboctahedra in dodecaborides undergo cooperative Jahn-Teller distortions, giving rise to dynamic charge stripes.
    Taken from prior work (refs 32-43) and used as the basis for interpreting MEM maps and transport anisotropy.
  • domain assumption Maximum entropy method reconstructions of X-ray diffraction data faithfully represent real electron density features, including interstices and dynamic stripes.
    The central evidence for s-CDW and stripes rests on MEM maps (Figs. 5-7); no validation against synthetic models or alternative reconstructions is provided.
  • ad hoc to paper The collective Jahn-Teller vibration of boron cages acts as a high-frequency plasmon capable of mediating electron-electron attraction in Zr-Zr pairs.
    This is the key physical premise of the proposed mechanism; no microscopic calculation is given (Discussion, Conclusions).
  • ad hoc to paper Little's 1964 excitonic pairing model, with lateral chains attached to a conducting spine, is applicable to the dynamic stripe and Zr-pair configuration in ZrB12.
    Invoked as an analogy in the Discussion: the configuration is described as similar to one long chain with lateral chains, as proposed by Little.
  • domain assumption ZrB12 is a two-gap strongly coupled s-wave superconductor in the dirty limit, and LuB12 differs mainly by stripe configuration.
    Adopted from prior papers (refs 48-53) and used to motivate the mechanism; not re-derived here.
invented entities (3)
  • Dynamic charge stripes (2p-type grids in ZrB12)
    purpose: Provide the 1D collective dynamics that synchronize Einstein phonons and mediate the proposed pairing.
    Inferred from MEM electron density maps and transport anisotropy; the dynamic, fluctuating nature is not directly measured, and no falsifiable handle outside this paper is specified.
  • Sub-structural charge density wave (s-CDW) with triangular lattice
    purpose: Responsible for the proposed phase transitions at T0 and Theta_E and for the L/L0 anomaly; proposed to pin and reorient stripes.
    Observed only via MEM maps in this paper; no independent probe such as diffuse scattering or STM is presented.
  • Vibrationally coupled Zr-Zr pairs
    purpose: Host the two electrons that pair via the composite plasmon-phonon mechanism.
    Inferred from anisotropy of electron density around Zr in MEM maps; no direct vibrational spectroscopy of the pairs is given.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Two-gap superconductor ZrB$_{12}$ with dynamic stripes and charge density waves: Crystal structure, physical properties and pairing mechanism." pith.science (2026). https://pith.science/paper/W5DRSDRU

@misc{pith2026250523424,
  author       = {Pith},
  title        = {Pith review of: Two-gap superconductor ZrB$_12$ with dynamic stripes and charge density waves: Crystal structure, physical properties and pairing mechanism},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/W5DRSDRU}},
  note         = {Machine review of arXiv:2505.23424}
}
abstract

A review of long-term studies of ZrB$_{12}$ and LuB$_{12}$ superconductors with very similar conduction bands and phonon spectra, but with radically different (by a factor of 15-20) critical temperatures and magnetic fields is presented. A detailed analysis of well-known studies in combination with new results of structural, thermodynamic and charge transport measurements obtained here for these metallic dodecaborides with Jahn-Teller instability of the rigid boron network and with dynamic charge stripes allows us to conclude in favor of the primary role of nanoscale effects of electron phase separation, leading to the formation of one-dimensional dynamic chains with different configurations of fluctuating charges, which in the case of ZrB$_{12}$ are predominantly $2p$-states, and for LuB$_{12}$-$5d$-$2p$ states. We propose a new plasmon-phonon pairing mechanism in ZrB$_{12}$, which may be common to different classes of high-$T_c$ superconductors.

Figures

Figures reproduced from arXiv: 2505.23424 by the authors.

Figure 1
Figure 1. Schematic representation of the NaCl-type unit cell of ZrB12. The dark balls are Zr atoms, the small green balls are B atoms, forming cuboctahedrons B12. The map of the electron density distribution in the cell face was obtained using the maximum entropy method (see text). To understand why ZrB12 becomes a superconductor at a Tc about 15 times higher than LuB12, Teyssier et al. [20] studied in detail specific heat, … view at source ↗
Figure 5
Figure 5. MEM maps of the ED distribution in the (111) plane of ZrB [PITH_FULL_IMAGE:figures/full_fig_p008_5.png] view at source ↗
Figure 6
Figure 6. MEM maps of the ED distribution in the (01 [PITH_FULL_IMAGE:figures/full_fig_p008_6.png] view at source ↗
Figures from the paper (9 more)
Figure 7
Figure 7. Figure 7: MEM maps of the ED distribution in parallel sections (001) [PITH_FULL_IMAGE:figures/full_fig_p009_7.png]
Figure 9
Figure 9. Figure 9: Temperature dependences of (a) resistivity ρ(T) and (b) Seebeck coefficient S(T) (temperature gradient ΔT//H//[110]) for ZrB12 and LuB12 in the wide temperature range 2-900 K. The approximations by the Einstein model Eqs. (1a), (2a), ρU(T) by Eq.(1b), and the power-law…
Figure 10
Figure 10. Figure 10: Temperature dependences of (a) thermal conductivity (T, H) LuB12 and ZrB12 at H=0 and 90 kOe and (b) normalized Lorentz number L/L0(T) (see text). The inset to panel (a) shows the large scale plot of (T, H) in ZrB12 in the range 20-400 K. Roman numerals I-IV corresp…
Figure 11
Figure 11. Figure 11: (a) Temperature dependences of specific heat C(T) for LuB12 and ZrB12 and the derivative dC/dT=f(T) for ZrB12. Panel (b) shows for ZrB12 the Debye (CD), Einstein (CE), linear Sommerfeld γT contributions to C(T) and the difference ΔC(T) that demonstrates two phase tran…
Figure 12
Figure 12. Figure 12: Field dependences of magnetoresistance for samples #1-#4 of ZrB12 at liquid helium temperature. The MR curve of LuB12 is shown for comparison. Inset presents the schematic view of the angular experiment with the sample rotation around the DC axis, n is the normal vect…
Figure 13
Figure 13. Figure 13: Angular dependences of resistivity of ZrB12 recorded at H=80 kOe for (a) the samples #1-#3 and (b) the sample #4. For comparison panel (b) demonstrates also the ρ(φ) curve for LuB12 [PITH_FULL_IMAGE:figures/full_fig_p015_13.png]
Figure 14
Figure 14. Figure 14: (a) Temperature dependences of the Hall coefficient measured at H=80 kOe for the samples #1- #4 of ZrB12 at various J-H configurations (see legend). Thick dashed line in panel (a) shows the data approximation by relation RH(T)=RH0 exp(-T0/T). Roman numerals II-IV corr…
Figure 15
Figure 15. Figure 15: MEM maps of ED distribution in (01-1) plane (a), (100) plane (c) and corresponding structural fragments (b, d) of ZrB12 at T=30 K. MEM map of ED distribution in (001) plane (e) and corresponding structural fragment (f) of LuB12 at T=50 K. The ED peaks are truncated at…
Figure 16
Figure 16. Figure 16: Temperature dependences of the products (a) [PITH_FULL_IMAGE:figures/full_fig_p018_16.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

88 extracted references · 80 canonical work pages

  1. [1]

    Superconductivity and Antiferromagnetism in Boron-Rich Latfices

    B. T. Matthias, T. H. Geballe, K. Andres, E. Corenzwit, G. W. Hull, and J. P. Maita, “Superconductivity and Antiferromagnetism in Boron-Rich Latfices”, Science 159, 530 (1968)

  2. [2]

    Electrical resistivity and superconductivity of LaB 6 and LuB12

    I. Bat'ko, M. Bat'kova, K. Flachbart, V.B. Filippov, Yu.B. Paderno, N.Yu. Shicevalova, Th. Wagner, “Electrical resistivity and superconductivity of LaB 6 and LuB12”, Journal of Alloys and Compounds 217, L1-L3 (1995)

  3. [3]

    Low Temperature Properties and Superconductivity of LuB12

    K. Flachbart, S. Gabani, K. Gloos, M. Mei ssner, M. Opel, Y. Paderno, V. Pavlık, P. Samuely, E. Schuberth, N. Shitsevalova, K. Siemensmeyer, and P. Szabo, “Low Temperature Properties and Superconductivity of LuB12”, Journal of Low Temperature Physics, 140 (5/6), 339-353 (2005)

  4. [4]

    Leithe -Jasper, A

    Α. Leithe -Jasper, A . Sato and T. Tanaka, “Refinement of the crystal structure of zirconium dodecaboride, ZrB12, at 140 Κ and 293 Κ“, Ζ. Kristallogr. New Crystal Structures, 217, 319-320, (2002)

  5. [5]

    Valence Structure of the Higher Borides

    W.N. Lipscomb, and D. Britton, “Valence Structure of the Higher Borides”, J. Ch em. Phys., 33, 275 (1960)

  6. [6]

    Electron Requirements of Bonds in Metal Borides

    R.W. Johnson and A.H. Daane, “Electron Requirements of Bonds in Metal Borides”, J. Chem. Phys., 38, 425 (1963)

  7. [7]

    Shein, A.L

    I.R. Shein, A.L. Ivanovskii, ”Band structure of superconducting dodecaborides YB 12 and ZrB12”, Phys. Solid State 45, 1429–1434 (2003)

  8. [8]

    Phys.: Condens

    B Jäger, S Paluch, O J Żogał,W Wolf, P Herzig, V B Filippov, N Shitsevalova and Y Paderno,” Characterization of the electronic properties of YB 12, ZrB12, and LuB 12 using 11B NMR and first- principles calculations”, J. Phys.: Condens. Matter 18, 2525–2535, (2006)

Show all 88 references
  1. [9]

    Electronic structure and bulk properties of MB6 and MB12 borides

    G. E. Grechnev, A. E. Baranovskiy, V. D. Fil, T. V. Ignatova, I. G. Kolobov, A. V. Logosha, N. Yu. Shitsevalova, V. B. Filippov and Olle Eriksson, “Electronic structure and bulk properties of MB6 and MB12 borides”, Low Temperature Physics 34, 921-929 (2008)

  2. [10]

    Specific heat, magnetic susceptibility, resistivity and thermal expansion of the superconductor ZrB12

    R. Lortz, Y. Wang, S. Abe, C. Meingast, Y. B. Paderno, V. Filippov, and A. Junod, “Specific heat, magnetic susceptibility, resistivity and thermal expansion of the superconductor ZrB12”, Phys. Rev. B 72, 024547 (2005)

  3. [11]

    Lattice dynamics in ZrB12 and LuB12: Ab initio calculations and inelastic neutron scattering measurements

    A. V. Rybina, K. S. Nemkovski, P. A. Alekseev, J. M. Mignot, E. S. Clementyev, M. Johnson, L. Capogna, A. V. Dukhnenko, A. B. Lyashenko, and V. B. Filippov, “Lattice dynamics in ZrB12 and LuB12: Ab initio calculations and inelastic neutron scattering measurements” // Phys. Rev...

  4. [12]

    Phonons in ZrB 12

    A. V. Rybina, K. S. Nemkovski, V. B. Filipov, and A. V. Dukhnenko, “Phonons in ZrB 12”, Phys. Solid State 52 (5), 894 - 898 (2010)

  5. [13]

    Localized vibrational mode analysis of the resistivity and specific heat of LaB6

    D. Mandrus, B. C. Sales, and R. Jin, “Localized vibrational mode analysis of the resistivity and specific heat of LaB6”, Phys. Rev. B 64, 012302 (2001)

  6. [14]

    Two -gap superconductivity in ZrB 12: Temperature dependence of critical magnetic fields in single crystals

    V. A. Gasparov, N. S. Sidorov, and I. I. Zver’kova, “Two -gap superconductivity in ZrB 12: Temperature dependence of critical magnetic fields in single crystals”, Phys. Rev. B 73, 094510 (2006)

  7. [15]

    Phonon drag induced by Einstein mode in ZrB 12

    V. Glushkov, M. Ignatov, S. Demishev, V. Filippov, K. Flachbart, T. Ishchenko, A. Kuznetsov, N. Samarin, N. Shitsevalova, and N. Sluchanko, “Phonon drag induced by Einstein mode in ZrB 12”, Phys. Stat. Sol. b 243 (11), R72–R74 (2006)

  8. [16]

    Magnetic excitations observed by means of inelastic neutron scattering in polycrystalline YbB12

    A. Bouvet, T. Kasuya, M. Bonnet, L. P. Regnault, J. Rossat_Mignod, F. Iga, B. Fеk, and A. Severing, “Magnetic excitations observed by means of inelastic neutron scattering in polycrystalline YbB12”, J. Phys.: Condens. Matter 10, 5667 – 5677, (1998)

  9. [17]

    Lattice dynamics and magneto - elastic coupling in Kondo-insulator YbB12

    A. V. Rybina, P. A. Alekseev, J. M. Mignot, E. V. Nefeodova, K. S. Nemkovski, R. I. Bewley, N. Yu. Shitsevalova, Yu. B. Paderno, F. Iga, and T. Takabatake, “Lattice dynamics and magneto - elastic coupling in Kondo-insulator YbB12”, J. Phys.: Conf. Ser. 92, 012074 (2007)

  10. [18]

    Thermal properties of rare earth dodecaborides

    A. Czopnik, N. Shitsevalova, A. Krivchikov, V. Pluzhnikov, Y. Paderno, and Y. Onuki, “Thermal properties of rare earth dodecaborides”, J. Solid State Chem. 177, 507 - 514 (2004)

  11. [19]

    Czopnik, N

    A. Czopnik, N. Shitsevalova, V. Pluzhnikov, A. Krivchikov, Yu. Paderno, and Y. Onuki, ”Low - temperature thermal properties of yttrium and lutetium dodecaborides”, J. Phys.: Condens. Matter 17, 5971 – 5985, (2005)

  12. [20]

    Effect of electron-phonon coupling on the superconducting tra nsition temperature in dodecaboride superconductors: A comparison of LuB12 with ZrB12

    J. Teyssier, R. Lortz, A. Petrovic, D. van der Marel, V. Filippov and N. Shitsevalova, “Effect of electron-phonon coupling on the superconducting tra nsition temperature in dodecaboride superconductors: A comparison of LuB12 with ZrB12”, Physical Review B 78, 134504 (2008)

  13. [21]

    Peculiarities in the Raman spectra of ZrB12 and LuB 12 single crystals

    H. Werheit, Yu. Paderno, V. Filippov, V. Paderno, A. Pietraszko, M. Armbrüster, U. Schwarz, “Peculiarities in the Raman spectra of ZrB12 and LuB 12 single crystals”, Journal of Solid State Chemistry 179, 2761–2767, (2006)

  14. [22]

    Optical study of electronic structure and electr on-phonon coupling in ZrB 12

    J. Teyssier, A. B. Kuzmenko, D. van der Marel, F. Marsiglio, A. B. Liashchenko, N. Shitsevalova, and V. Filippov, “Optical study of electronic structure and electr on-phonon coupling in ZrB 12”, Physical Review B 75, 134503, (2007)

  15. [23]

    Effects of Disorder and Isotopic Substitution in the Specific Heat and Raman Scattering in LuB 12

    N. E. Sluchanko, A. N. Azarevich, A. V. Bogach, I. I. Vlasov, V. V. Glushkov, S. V. Demishev, A. A. Maksimov, I. I. Tartakovskii, E. V. Filatov, K. Flachbart, S. Gabani, V. B. Filippov, N. Yu. Shitsevalova, and V. V. Moshchalkov, “Effects of Disorder and Isotopic Substitution ...

  16. [24]

    Superconductivity in ZrB 12 and LuB12 with Various Boron Isotopes

    N. Sluchanko, S. Gavrilkin, K. Mitsen, A. Kuznetsov, I. Sannikov, V. Glushkov, S. Demishev, A. Azarevich, A. Bogach, A. Lyashenko, A. Dukhnenko, V. Filipov, S. Gabani, K. Flachbart, J. Vanacken, Gufei Zhang, V. Moshchalkov, “Superconductivity in ZrB 12 and LuB12 with Various B...

  17. [25]

    N. E. Sluchanko, A. N. Azarevich, M. A. Anisimov, A. V. Bogach, S. Yu. Gavrilkin,V. V. Glushkov, S. V. Demishev, A. A. Maksimov, I. I. Tartakovskii, E. V. Filatov, V. B. Filippov, and A. B. Lyashchenko, ”Raman Scatt ering in ZrB 12 Cage Glass”, JETP Letters 103 (11), 674–679, (2016)

  18. [26]

    Suppression of superconductivity in Lu xZr1−xB12: Evidence of static magnetic moments induced by nonmagnetic impurities

    N. E. Sluchanko, A. N. Azarevich, M. A. Anisimov, A. V. Bogach, S. Yu. Gavrilkin, M. I. Gilmanov, V. V. Glushkov, S. V. Demishev, A. L. Khoroshilov, A. V. Dukhnenko, K. V. Mitsen, N. Yu. S hitsevalova, V. B. Filippov, V. V. Voronov, and K. Flachbart, “Suppression of supercondu...

  19. [27]

    Isotope Effect in Charge Transport of LuB12

    N. E. Sluchanko, A. N. Azarevich, A. V. Bogach, V. V. Glushkov, S. V. Demishev, A. V. Kuznetsov, K. S. Lyubshov, V. B. Filippov, and N. Yu. Shitsevalova, “Isotope Effect in Charge Transport of LuB12”, JETP 111 (2), 279 – 284, (2010)

  20. [28]

    Anomalous charge transport in RB12 (R = Ho, Er, Tm, Lu)

    N. Sluchanko, L. Bogomolov, V. Glushkov, S. Demishev, M. Ignatov, Eu. Khayrullin, N. Samarin, D. Sluchanko, A. Levchenko, N. Shitsevalova, and K. Flachbart, “Anomalous charge transport in RB12 (R = Ho, Er, Tm, Lu)”, Phys. Status Solidi B 243, R63 – R65, (2006)

  21. [29]

    Anomalies of Magnetoresistance of Compounds with Atomic Clusters RB12 (R = Ho, Er, Tm, Lu)

    N. E. Sluchanko, A. V. Bogach, V. V. Glushkov, S. V. Demishev, N. A. Samarin, D. N. Sluchanko, A. V. Dukhnenko, and A. V. Levchenko, “Anomalies of Magnetoresistance of Compounds with Atomic Clusters RB12 (R = Ho, Er, Tm, Lu)”, JETP 108 (4), 668 - 687, (2009)

  22. [30]

    Jahn -Teller effect of th e B12 icosahedron and its general influence on the valence band structures of boron-rich solids

    R. Franz, and H. Werheit, “Jahn -Teller effect of th e B12 icosahedron and its general influence on the valence band structures of boron-rich solids”, Europhys. Lett. 9 (2), 145–150, (1989)

  23. [31]

    Influence of the Jahn -Teller effect on the electronic band structure of boron-rich solids containing B12 icosahedra

    R. Franz, and H. Werheit, “Influence of the Jahn -Teller effect on the electronic band structure of boron-rich solids containing B12 icosahedra”, AIP Conf. Proc. 231, 29–36 (1991)

  24. [32]

    Rattling mode and symmetry lowering resulting from the instability of the B 12 molecule in LuB12

    N. Sluchanko, A. Bogach, N. Bolotina, V. Glushkov, S. Demishev, A. Dudka, V. Krasnorussky, O. Khrykina, K. Krasikov, V. Mironov, V. B. Filipov, and N. Shitsevalova, “Rattling mode and symmetry lowering resulting from the instability of the B 12 molecule in LuB12”, Phys. Rev. B...

  25. [33]

    Co -operative Jahn-Teller effects

    G. A. Gehring and K. A. Gehring, “Co -operative Jahn-Teller effects”, Rep. Prog. Phys. 38, 1–89, (1975)

  26. [34]

    Vibronic interactions in molecules and crystals

    I. B. Bersuker and V. Z. Polinger (eds.), “Vibronic interactions in molecules and crystals”, Springer Series in Chemical Physics 49, (Springer, Berlin, Heidelberg, 1989)

  27. [35]

    M. D. Kaplan and B. G.Vekhter, Cooperative phenomena in Jahn-Teller crystals (Plenum Press, New York, 1995)

  28. [36]

    Bersuker, The Jahn-Teller Effect (Cambridge University Press, Cambridge, 2006)

    I. Bersuker, The Jahn-Teller Effect (Cambridge University Press, Cambridge, 2006)

  29. [37]

    Flachbart, P

    K. Flachbart, P. Alekseev, G. Grechnev, N. Shitsevalova, K. Siemensmeyer, N. Sluchanko and O. Zogal, Rare Earths: Research and Applications ed. K. N. Delfrey (Hauppauge, NY: Nova Science), pp 79–125 (2008)

  30. [38]

    A. P. Dudka, I. A. Verin, E. S. Smirnova, ”Calibration of Cryojet and Cobra Plus cryosystems used in X-ray diffraction studies”, Crystallogr. Rep. 61, 692–696 (2016)

  31. [39]

    Dudka, O.N

    A.P. Dudka, O.N. Khrykina, N.B. Bolotina, N.Yu. Shitsevalova, ”Jahn –Teller lattice distortions and asymmetric electron density distribution in the structure of TmB 12 dodecaboride in the temperature range of 85–293 K”, Crystallography Reports 64 (5), 737–742, (2019)

  32. [40]

    Bolotina, A.P

    N.B. Bolotina, A.P. Dudka, O.N. Khrykina, V.N. Krasnorussky, N.Yu. Shitsevalova, V.B. Filipov, N.E. Sluchanko, ”The lower symmetry electron -density distribution and the charge transport anisotropy in cubic dodecaboride LuB12”, J. Phys.: Condens. Matter 30, 265402, (2018)

  33. [41]

    On the role of isotopic composition in crystal structure, thermal and charge -transport characteristics of dodecaborides LuNB12 with the Jahn-Teller instability

    N.B. Bolotina, A.P. Dudka, O.N. Khrykina, V.V. Glushkov, A.N. Azarevich, V.N. Krasnorussky, S. Gabani, N.Yu. Shitsevalova, A.V. Dukhnenko, V.B. Filipov, N.E. Sluchanko, “On the role of isotopic composition in crystal structure, thermal and charge -transport characteristics of ...

  34. [42]

    Structural instability and poorly defined phase transitions in rare -earth dodecaborides RB12 (R=Ho-Lu) at intermediate temperatures

    O. N. Khrykina, A. P. Dudka, N. B. Bolotina, N. E. Sluchanko, N. Yu. Shitsevalova, “Structural instability and poorly defined phase transitions in rare -earth dodecaborides RB12 (R=Ho-Lu) at intermediate temperatures”, Solid State Sciences 107, 106273, (2020)

  35. [43]

    Crystal structure of dodecaborides: complexity in simplicity

    N. B. Bolotina, A. P. Dudka, O. N. Khrykina, V.S. Mironov, “Crystal structure of dodecaborides: complexity in simplicity”, in Rare-Earth Borides , edited by D. S. Inos ov (Jenny Stanford Publishing, Singapore, 2021), Chap.3, pp. 293-330

  36. [44]

    Hall effect and symmetry breaking in non -magnetic metal with dynamic charge stripes

    N. Sluchanko, A. Azarevich, A. Bogach, S. Demishev, K. Krasikov, V. Voronov, V. Filipov, N. Shitsevalova, V. Glushkov , “Hall effect and symmetry breaking in non -magnetic metal with dynamic charge stripes”, Phys. Rev. B 103, 035117, (2021)

  37. [45]

    Ion pairs and spontaneous break of symmetry in the valence-fluctuating compound YbB12

    T. S. Altshuler, Y. V. Goryunov, M. S. Bresler, F. Iga, T. Takabatake, “Ion pairs and spontaneous break of symmetry in the valence-fluctuating compound YbB12” // Phys. Rev. B 68, 014425, (2003)

  38. [46]

    Fine details of crystal structure and atomic vibrations in YbB12 with a metal–insulator transition

    N. Bolotina, O. Khrykina, A. Azarevich, S. Gavrilkin, and N. Sluchanko, “Fine details of crystal structure and atomic vibrations in YbB12 with a metal–insulator transition”, Acta Cryst. B 76, 1117– 1127, (2020)

  39. [47]

    Crystal - field potential and short-range order effects in inelastic neutron scattering, magnetization, and heat capacity of the cage-glass compound HoB12

    B. Z. Malkin, E. A. Goremychkin, K. Siemensmeyer, S. Gabáni, K. Flachbart, M. Rajňák, A. L. Khoroshilov, K. M. Krasikov, N. Yu. Shitsevalova, V. B. Filipov, and N. E. Sluchanko, “Crystal - field potential and short-range order effects in inelastic neutron scattering, magnetiza...

  40. [48]

    Inhomogeneous superconductivity in LuxZr1−xB12 dodecaborides with dynamic charge stripes

    A. Azarevich, A. Bogach, V. Glushkov, S. Demishev, A. Khoroshilov, K. Krasikov, V. Voronov, N. Shitsevalova, V. Filipov, S. Gabáni, K. Flachbart, A. Kuznetsov, S. Gavrilkin, K. Mitsen, S. J. Blundell, N. E. Sluchanko, “Inhomogeneous superconductivity in LuxZr1−xB12 dodecaborid...

  41. [49]

    Observation of a crossover from nodal to gapped superconductivity in LuxZr1-xB12

    F. K. K. Kirschner, N. E. Sluchanko, V. B. Filipov, F. L. Pratt, C. Baines, N. Yu. Shitsevalova, and S. J. Blundell, “Observation of a crossover from nodal to gapped superconductivity in LuxZr1-xB12”, Phys. Rev. B 98, 094505, (2018)

  42. [50]

    Checkerboard patterns of charge stripes in a two -gap superconductor ZrB12

    N. B. Bolotina, O. N. Khrykina, A. N. Azarevich, N. Yu. Shitsevalova, V. B. Filipov, S. Yu. Gavrilkin, K. V. Mitsen, N. E. Sluchanko, “Checkerboard patterns of charge stripes in a two -gap superconductor ZrB12”, Phys. Rev B 105, 054511, (2022)

  43. [51]

    Coexistence of type -I and type-II superconductivity signatures in ZrB12 probed by muon spin rotation measurements

    P. K. Biswas, F. N. Rybakov, R. P. Singh, Saumya Mukherjee, N. Parzyk, G. Balakrishnan, M. R. Lees, C. D. Dewhurst, E. Babaev, A. D. Hillier, and D. Mc K. Paul, “Coexistence of type -I and type-II superconductivity signatures in ZrB12 probed by muon spin rotation measurements”...

  44. [52]

    Anisotropic superconductivity in ZrB12 near the critical Bogomolnyi point

    S. Datta, S. Howlader, A. R. Prakash Singh, G. Sheet, “Anisotropic superconductivity in ZrB12 near the critical Bogomolnyi point”, Phys. Rev. B 105, 094504, (2022)

  45. [53]

    Low temperature singularities of electron density in a two -gap superconductor ZrB12

    N.B. Bolotina, O.N. Khrykina, A.N. Azarevich, N.Yu. Shitsevalova, V.B. Filipov, S.Yu. Gavrilkin, A.Yu. Tsvetkov, S. Gabáni, K. Flachbart, V.V. Voronov, N.E. Sluchanko, “Low temperature singularities of electron density in a two -gap superconductor ZrB12”, Solid St. Sci. 142, 1...

  46. [54]

    Complex spectral evolution in a BCS superconductor ZrB12

    S. Thakur et al., D. Biswas, N. Sahadev, P. K. Biswas, G. Balakrishnan, K. Maiti, “Complex spectral evolution in a BCS superconductor ZrB12”, Sci. Rep. 3, 3342, (2013)

  47. [55]

    A Spin Fluctuation for dwave Superconductivity. In The Physics of Superconductors

    A. Chubukov, D. Pines, J. Schmalian, “A Spin Fluctuation for dwave Superconductivity. In The Physics of Superconductors”, Vol. I: Conventional and High -Tc Superconductors , K -H. Benneman, J. B. Ketterson, Eds. (Springer: Berlin, 2003), pp 1349- 1407

  48. [56]

    Anomalous High-Temperature Superconductivity in YH6

    I. A. Troyan, D. V. Semenok, A. G. Kvashnin, A. V. Sadakov, O. A. Sobolevskiy, V. M. Pudalov, A. G. Ivanova, V. B. Prakapenka, E. Greenberg, A. G. Gavriliuk, I. S. Lyubutin, V. V. Struzhkin, A. Bergara, I. Errea, R. Bianco, M. Calandra, F. Mauri, L. Monacelli, R. Akashi, and A...

  49. [57]

    High -temperature superconductivity in hydrides

    I. A. Troyan, D. V. Semenok, A. G. Ivanova, A. G. Kvashnin, D. Zhou, A. V. Sadakov, O. A. Sobolevskiy, V. M. Pudalov, I. S. Lyubutin, A. R. Oganov, “High -temperature superconductivity in hydrides”, UFN 192, 799–813, (2022)

  50. [58]

    High -temperature superconductivity on the verge of a structural instability in lanthanum superhydride

    D. Sun, V. S. Minkov, S. Mozaffari, Y. Sun, Y. Ma, S. Chariton, V. B. Prakapenka, M. I. Eremets, L. Balicas, F. F. Balakirev, “High -temperature superconductivity on the verge of a structural instability in lanthanum superhydride”, Nat. Comm. 12, 6863, (2021)

  51. [59]

    Crystal chemistry and crystal growth of rare -earth borides

    N. Shitsevalova, “Crystal chemistry and crystal growth of rare -earth borides”, in: edited by D. S. Inosov, Rare-Earth Borides, (Jenny Stanford Publishing, Singapore, 2021), Chap. 1, pp. 1– 243

  52. [60]

    Hall and Transverse Even Effects in the Vicinity of a Quantum Critical Point in Tm 1 – xYbxB12

    N. E. Sluch anko, A. N. Azarevich, A. V. Bogach, V. V. Glushkov , S. V. Demishev, M. A. Anisimov, A. V. Levchenko, V. B. Filipov, N. Yu. Shitsevalova, “Hall and Transverse Even Effects in the Vicinity of a Quantum Critical Point in Tm 1 – xYbxB12”, J. Exp. Theor. Phys. 115, 50...

  53. [61]

    Observation of dynamic charge stripes at the metal-insulator transition in Tm0.19Yb0.81B12

    N. E. Sluchanko, A. N. Azarevich, A. V. Bogach, N. B. Bolotina, V. V. Glushkov, S. V. Demishev, A. P. Dudka, O. N. Khrykina, V. B. Filipov, N. Yu. Shitsevalova, G. A. Komandin, A. V. Muratov, Yu. A. Aleshchenko, E. S. Zhukova, B. P. G orshunov, “Observation of dynamic charge s...

  54. [62]

    Crystallographic Computing System JANA2006: General Features

    V. Petříček, M. Dušek, L. Palatinus, “Crystallographic Computing System JANA2006: General Features”, Z. Kristallogr. 229, 345–352, (2014)

  55. [63]

    DebyeFit: a simple tool to get an appropriate model of atomic vibrations in solids from atomic displacement parameters obtained at different temperatures

    A. P. Dudka, N. B. Bolotina, O. N. Khrykina, “DebyeFit: a simple tool to get an appropriate model of atomic vibrations in solids from atomic displacement parameters obtained at different temperatures”, J. Appl. Cryst. 52, 690–692, (2019)

  56. [64]

    the Frontier of Centuries Advantages and Challenges

    Y. Paderno, A. Liashchenko, V. Filippov, and A. Dukhnenko, in Science for Materials , “the Frontier of Centuries Advantages and Challenges”, Conf. Proc. IPMS NASU, edited by V. Skorokhod, Kiev, 2002, p. 404

  57. [65]

    Ultrastrong Boron Frameworks in ZrB 12: A Highway for Electron Conducting

    Ma, T., L, H., Zheng, X., Wang, Sh., Wang, X., Zhao, H., Han, S., Liu, J., Zhang, R., Zhu, P., Long, Y., Cheng J., Ma, Y., Zhao, Yu., Jin, Ch. & Yu, Xiaohui, “Ultrastrong Boron Frameworks in ZrB 12: A Highway for Electron Conducting”, Adv. Mater. 29, 1604003, (2017)

  58. [66]

    Electrical resistivity of an Einstein solid

    J.R. Cooper, “Electrical resistivity of an Einstein solid”, Phys. Rev. B 9, 2778, (1974)

  59. [67]

    Chaikin, In: Organic superconductivity, ed

    P.M. Chaikin, In: Organic superconductivity, ed. by V.Z. Kresin and W.A. Little, Plenum Press, New York (1990), p.101

  60. [68]

    Recent experiments on interlayer tunneling spectroscopy and transverse electric field effect in NbSe3

    Yu.I. Latyshev, A.P. Orlov , A.Yu. Latyshev, A. -M. Smolovich, P. Monc eau, and D. Vignolles, "Recent experiments on interlayer tunneling spectroscopy and transverse electric field effect in NbSe3", Physica B 404, 399-403, (2009)

  61. [69]

    Thermal conductivity of rare- earth element dodecaborides

    H Misiorek, J Mucha, A Jezowski, Y Paderno and N Shitsevalova, “Thermal conductivity of rare- earth element dodecaborides”, J. Phys.: Condens. Matter 7, 8927, (1995)

  62. [70]

    Low -Temperature Crystallization of Structural Defects in LuB12 According to 175Lu NMR Data

    O.M. Vyaselev, A.A. Gippius, N.E. Sluchanko, N.Yu. Shitsevalova, “Low -Temperature Crystallization of Structural Defects in LuB12 According to 175Lu NMR Data” // JETP Letters 119, 529–533, (2024)

  63. [71]

    Fluctuation effects on the Pauli susceptibility at a Peierls transition

    P Chandra, “Fluctuation effects on the Pauli susceptibility at a Peierls transition”, J. Phys.: Condens. Matter 1, 10067 -10080, (1989)

  64. [72]

    Breaking of Cubic Symmetry in Rare-Earth Dodecaborides with Dynamic Charge Stripes

    K. M. Krasikov, A. N. Azarevich, V. V. Glushkov, S. V. Demishev, A. L. Khoroshilov, A. V. Bogach, N. Yu. Shitsevalova, V. B. Filippov, and N. E. Sluchanko, “Breaking of Cubic Symmetry in Rare-Earth Dodecaborides with Dynamic Charge Stripes”, JETP Letters 112, 415–421, (2020)

  65. [73]

    Study of the Fermi Surface of ZrB 12 Using the de Haas-van Alphen Effect

    V. A. Gasparov, I. Sheikin, F. Levy, J. Teyssier, G. Santi, “Study of the Fermi Surface of ZrB 12 Using the de Haas-van Alphen Effect”, Phys. Rev. Lett. 101, 097006, (2008)

  66. [74]

    Charge density waves in strongly correlated electron systems

    Chih-Wei Chen, Jesse Choe and E Morosan, “Charge density waves in strongly correlated electron systems”, Rep. Prog. Phys. 79, 084505, (2016)

  67. [75]

    Misconceptions associated with the origin of charge density waves

    Xuetao Zhu, Jiandong Guo, Jiandi Zhang, E. W. Plummer, “Misconceptions associated with the origin of charge density waves”, Advances in Physics: X 2 (3), 622-640, (2017)

  68. [76]

    Collective Infrared Excitation in LuB12 Cage-Glass

    B. P. Gorshunov, E. S. Zhu kova, G. A. Komandin, V. I. Torgashev, A. V. Muratov, Yu. A. Aleshchenko, S. V. Demishev, N. Yu. Shitsevalova, V. B. Filipov N. E. Sluchanko, “Collective Infrared Excitation in LuB12 Cage-Glass”, JETP Letters 107, 100, (2018)

  69. [77]

    Possibil ity of Synthesizing an Organic Superconductor

    W.A. Little, “Possibil ity of Synthesizing an Organic Superconductor”, Phys. Rev. 134, A1416 (1964)

  70. [78]

    High-Temperature Superconductivity , Eds. V.L. Ginzburg, D.A. Kirzhnits (New York: Consultant Bureau, 1982)

  71. [79]

    Raman study of coupled electronic and phononic excitations in LuB12

    Yu. S. Ponosov , A.A. Makhnev , S.V. Streltsov , V.B. Filipov , N. Yu. Shitsevalova, “Raman study of coupled electronic and phononic excitations in LuB12”, Journal of Alloys and Compounds 704, 390-397, (2017)

  72. [80]

    Lattice instability and enhancement of superconductivity in YB6

    N. Sluchanko, V. Glushkov, S. Demishev, A. Azarevich, M. Anisimov, A. Bogach, V. Voronov, S. Gavrilkin, K. Mitsen, A . Kuznetsov, I. Sannikov, N. Shitsevalova, Filipov, M. Kondrin, S. Gabáni and K. Flachbart, “Lattice instability and enhancement of superconductivity in YB6”, P...

  73. [81]

    Kosevich, Theory of Crystal Lattice , Kharkov State Universi ty, Vishcha Shkola, Kharkov, 1988 (in Russian); Translated into English: WILEY-VCH, Berlin, New York, 1999

    A.M. Kosevich, Theory of Crystal Lattice , Kharkov State Universi ty, Vishcha Shkola, Kharkov, 1988 (in Russian); Translated into English: WILEY-VCH, Berlin, New York, 1999

  74. [82]

    Anselm, Introduction to Semiconductor Theory , Translated from the Russian

    A. Anselm, Introduction to Semiconductor Theory , Translated from the Russian. (Mir, Moscow, 1981). 645 p

  75. [83]

    On the Mutual Interaction of Parallel Phonons

    S. Simons, “On the Mutual Interaction of Parallel Phonons”, Proc. Phys. Soc. 82, 401, (1963)

  76. [84]

    Role of Low-Energy Phonons in Thermal Conduction

    C. Herring, “Role of Low-Energy Phonons in Thermal Conduction”, Phys. Rev. 95, 954, (1954)

  77. [85]

    Collective and quasi-local modes in the optical spectra of YB6 and YbB6 hexaborides with Jahn–Teller structural instability

    N.E. Sluchanko, E.S. Zhukova, L.N. Alyabyeva, B.P. Gorshunov, A.V. Muratov, Yu.A. Aleshchenko, A.N. Azarevich, M. A. Anisimov, N.Yu. Shitsevalova, S.E. Polovets, and V.B. Filipov, “Collective and quasi-local modes in the optical spectra of YB6 and YbB6 hexaborides with Jahn–Te...

  78. [86]

    Boron 10B-11B isotope substitution as a probe of the mechanism responsible for the record thermionic emission in LaB6 with the Jahn-Teller instability

    E.S. Zhukova, B.P. Gorshu nov, M. Dressel, G.A. Komandin, M.A. Belyanchikov, Z.V. Bedran, A.V. Muratov, Y.A. Aleshchenko, M.A. Anisimov, N.Yu. Shitsevalova, A.V. Dukhnenko, V.B. Filipov, V.V. Voronov, and N.E. Sluchanko, “Boron 10B-11B isotope substitution as a probe of the me...

  79. [87]

    Collective infrared excitation in rare−earth GdxLa1−xB6 hexaborides

    E.S. Zhukova, B.P. Gorshunov, G.A. Komandin, L.N. Alyabyeva, A.V. Muratov, Yu.A. Aleshchenko, M.A. Anisimov, N.Yu. Shitsevalova, S.E. P olovets, V.B. Filipov, V.V. Voronov, and N.E. Sluchanko, “Collective infrared excitation in rare−earth GdxLa1−xB6 hexaborides”, Phys. Rev. B ...

  80. [88]

    Evidence for spin droplets (ferrons) formation in the heavy fermion metal CeB 6 with dynamic charge strip es

    A.N. Azarevich, O.N. Khrykina, N.B. Bolotina, V.G. Gridchina, A.V. Bogach, S.V. Demishev, V.N. Krasnorussky, S. Yu. Gavrilkin, A.Yu. Tsvetkov,N.Yu. Shitsevalova, V.V. Voronov, K.I. Kugel, A.L. Rakhmanov, S. Gabáni, K. Flachbart, N.E. Sluchanko, “Evidence for spin droplets (fer...

Pith tools

Reviewed August 7, 2026 · model on record in the stance chip above.