pith. sign in

arxiv: 1611.06153 · v1 · pith:WXB2ZZROnew · submitted 2016-11-18 · ❄️ cond-mat.mes-hall

Propagating spin-wave normal modes: A dynamic matrix approach using plane-wave demagnetizating tensors

classification ❄️ cond-mat.mes-hall
keywords magneticdynamicspin-wavesinteractionspropagatingapproachdemagnetizationfactors
0
0 comments X
read the original abstract

We present a finite-difference micromagnetic approach for determining the normal modes of spin-waves propagating in extended magnetic films and strips, which is based on the linearized Landau-Lifshitz equation and uses the dynamic matrix method. The model takes into account both short range exchange interactions and long range dipole-dipole interactions. The latter are accounted for through plane-wave dynamic demagnetization factors, which depend not only on the geometry and relative positions of the magnetic cells, as usual demagnetization factors do, but also on the wave vector of the propagating waves. Such a numerical model is most relevant when the spin-wave medium is spatially inhomogeneous perpendicular to the direction of propagation, either in its magnetic properties or in its equilibrium magnetic configuration. We illustrate this point by studying surface spin-waves in magnetic bilayer films and spin-waves channelized along magnetic domain walls in perpendicularly magnetized strips. In both cases, dynamic dipolar interactions produce non-reciprocity effects, where counter-propagative spin-waves have different frequencies.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.