Pith. sign in

REVIEW 2 cited by

Dynamic EventNeRF: Reconstructing General Dynamic Scenes from Multi-view RGB and Event Streams

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2412.06770 v4 pith:XJNVV632 submitted 2024-12-09 cs.CV

classification cs.CV
keywords eventmulti-viewcamerasdynamicfastlightingmotioncapture
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Volumetric reconstruction of dynamic scenes is an important problem in computer vision. It is especially challenging in poor lighting and with fast motion. This is partly due to limitations of RGB cameras: To capture frames under low lighting, the exposure time needs to be increased, which leads to more motion blur. In contrast, event cameras, which record changes in pixel brightness asynchronously, are much less dependent on lighting, making them more suitable for recording fast motion. We hence propose the first method to spatiotemporally reconstruct a scene from sparse multi-view event streams and sparse RGB frames. We train a sequence of cross-faded time-conditioned NeRF models, one per short recording segment. The individual segments are supervised with a set of event- and RGB-based losses and sparse-view regularisation. We assemble a real-world multi-view camera rig with six static event cameras around the object and record a benchmark multi-view event stream dataset of challenging motions. Our work outperforms RGB-based baselines, producing state-of-the-art results, and opens up the topic of multi-view event-based reconstruction as a new path for fast scene capture beyond RGB cameras. The code and the data are released at https://4dqv.mpi-inf.mpg.de/DynEventNeRF/

Discussion (0). Sign in to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. E-4DGS: High-Fidelity Dynamic Reconstruction from the Multi-view Event Cameras

    cs.CV 2025-08 conditional novelty 6.0 of 10

    E-4DGS is a deformable 3D Gaussian Splatting method that reconstructs dynamic scenes directly from multi-view event camera streams, outperforming event-to-image baseline approaches.

  2. Event Camera Guided Visual Media Restoration & 3D Reconstruction: A Survey

    cs.CV 2025-09 conditional novelty 1.0 of 10

    A structured survey of event-camera-guided video restoration and 3D reconstruction, organized by temporal, spatial, and 3D tasks.

Pith tools