Pith. sign in

REVIEW 2 cited by

Thick domain wall spacetimes with and without reflection symmetry

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv gr-qc/0211081 v1 pith:XV5EIKCH submitted 2002-11-25 gr-qc

classification gr-qc
keywords asymmetricspacetimeswallsreflectionsolutionssymmetrywallcase
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

We show that the spacetimes of domain wall solutions to the coupled Einstein-scalar field equations with a given scalar field potential fall into two classes, depending on whether or not reflection symmetry on the wall is imposed. Solutions with reflection symmetry are dynamic, while the asymmetric ones are static. Asymmetric walls are asymptotically flat on one side and reduce to the Taub spacetime on the other. Examples of asymmetric thick walls in D-dimensional spacetimes are given, and results on the thin-wall limit of the dynamic, symmetric walls are extended to the asymmetric case. The particular case of symmetric, static spacetimes is considered and a new family of solutions, including previously known BPS walls, is presented.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Two-scalar-field $f(R)$ Thick Branes, Gravitational Resonances and Quasinormal Modes

    hep-th 2026-06 unverdicted novelty 4.0 of 10

    In ghost-free two-scalar f(R) thick branes, internal structure produces no narrow real-axis tensor resonances; quasinormal modes are broad with quality factors 0.9-1.9.

  2. Scalar-gravitational quasinormal modes and echoes in a five dimensional thick brane

    gr-qc 2025-08 conditional novelty 4.0 of 10

    Scalar perturbations of a split five-dimensional thick brane yield long-lived quasinormal modes and position-dependent echo waveforms: clean periodic echoes on a sub-brane and modulated echoes between sub-branes.

Pith tools