pith. sign in

arxiv: cond-mat/0101148 · v1 · submitted 2001-01-10 · ❄️ cond-mat

Surface Phase Diagrams for Wetting on Heterogenous Substrates

classification ❄️ cond-mat
keywords substratesphasesurfacesystemsinglystripedwettingable
0
0 comments X
read the original abstract

We propose a simplified description of fluid adsorption on heterogenenous micropatterned substrates. Using this approach, we are able to rederive results obtained earlier using effective interfacial Hamiltonian methods and predict a number of new examples of surface phase behaviour for both singly and periodically striped substrates. In particular, we show that, for a singly striped system, the manner in which the locus of surface unbending phase transitions approaches the pre-wetting line of the infinite pure system, in the limit of large stripe widths, is non-trivial and sensitive to several characteristic lengthscales and competing free-energies. For periodic substrates, we investigate finite-size deviations from Cassie's law for the wetting temperature of the heterogeneous system when the domain sizes are mesoscopic.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.