Pith. sign in

REVIEW 1 cited by

Rejuvenation of stellar mergers and the origin of magnetic fields in massive stars

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 1601.05084 v1 pith:3NVBU4LD submitted 2016-01-19 astro-ph.SR

Rejuvenation of stellar mergers and the origin of magnetic fields in massive stars

classification astro-ph.SR
keywords starsmagneticbinarymergerfieldsmassivemergersproducts
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
read the original abstract

Approximately 10% of massive OBA main-sequence (MS) and pre-MS stars harbour strong, large-scale magnetic fields. At the same time there is a dearth of magnetic stars in close binaries. A process generating strong magnetic fields only in some stars must be responsible with the merging of pre-MS and MS stars being suggested as one such channel. Stars emerging from the coalescence of two MS stars are rejuvenated, appearing younger than they are. They can therefore be identified by comparison with reference clocks. Here we predict the rejuvenation of MS merger products over a wide range of masses and binary configurations calibrated to smoothed-particle-hydrodynamical merger models. We find that the rejuvenation is of the order of the nuclear timescale and is strongest in the lowest-mass mergers and the most evolved binary progenitors with the largest mass ratios. These predictions allow us to put constraints on the binary progenitors of merger products. We show that the magnetic stars HR 2949 and $\tau$ Sco are younger than the potential binary companion HR 2948 and the Upper-Sco association, respectively, making them promising merger candidates. We find that the age discrepancies and the potential binary progenitors of both are consistent with them being rejuvenated merger products, implying that their magnetic fields may originate from this channel. Searching for age discrepancies in magnetic stars is therefore a powerful way to explore which fraction of magnetic stars may have obtained their strong magnetic field in MS mergers and to improve our understanding of magnetism in massive stars and their remnants.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Examining the stellar-merger origin of the blue main sequence in the open cluster NGC\,3532 with N-body simulations

    astro-ph.GA 2026-07 conditional novelty 6.0

    N-body models of NGC 3532 produce only 0-8 stellar mergers, too few to explain the cluster's ~37% blue main-sequence population, disfavoring the merger origin for its slow rotators.