pith. machine review for the scientific record. sign in

arxiv: 1802.10269 · v1 · submitted 2018-02-28 · 💻 cs.AI

Recognition: unknown

Selective Experience Replay for Lifelong Learning

Authors on Pith no claims yet
classification 💻 cs.AI
keywords forgettinglearningdistributionexperiencematchingreplaytaskswhen
0
0 comments X
read the original abstract

Deep reinforcement learning has emerged as a powerful tool for a variety of learning tasks, however deep nets typically exhibit forgetting when learning multiple tasks in sequence. To mitigate forgetting, we propose an experience replay process that augments the standard FIFO buffer and selectively stores experiences in a long-term memory. We explore four strategies for selecting which experiences will be stored: favoring surprise, favoring reward, matching the global training distribution, and maximizing coverage of the state space. We show that distribution matching successfully prevents catastrophic forgetting, and is consistently the best approach on all domains tested. While distribution matching has better and more consistent performance, we identify one case in which coverage maximization is beneficial - when tasks that receive less trained are more important. Overall, our results show that selective experience replay, when suitable selection algorithms are employed, can prevent catastrophic forgetting.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. COMPASS: COntinual Multilingual PEFT with Adaptive Semantic Sampling

    cs.LG 2026-04 unverdicted novelty 6.0

    COMPASS uses semantic clustering on multilingual embeddings to select auxiliary data for PEFT adapters, outperforming linguistic-similarity baselines on multilingual benchmarks while supporting continual adaptation.