pith. sign in

arxiv: 0902.3632 · v1 · submitted 2009-02-20 · ❄️ cond-mat.stat-mech · physics.bio-ph· q-bio.BM· q-bio.QM

Dynamic force spectroscopy of DNA hairpins. I. Force kinetics and free energy landscapes

classification ❄️ cond-mat.stat-mech physics.bio-phq-bio.BMq-bio.QM
keywords forceenergyfreederivehairpinhairpinskinetickinetics
0
0 comments X
read the original abstract

We investigate the thermodynamics and kinetics of DNA hairpins that fold/unfold under the action of applied mechanical force. We introduce the concept of the molecular free energy landscape and derive simplified expressions for the force dependent Kramers-Bell rates. To test the theory we have designed a specific DNA hairpin sequence that shows two-state cooperative folding under mechanical tension and carried out pulling experiments using optical tweezers. We show how we can determine the parameters that characterize the molecular free energy landscape of such sequence from rupture force kinetic studies. Finally we combine such kinetic studies with experimental investigations of the Crooks fluctuation relation to derive the free energy of formation of the hairpin at zero force.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.