pith. sign in

arxiv: 1403.6714 · v1 · pith:UZD33D5Jnew · submitted 2014-03-26 · 🧮 math.CO · math-ph· math.MP· quant-ph

Veldkamp-Space Aspects of a Sequence of Nested Binary Segre Varieties

classification 🧮 math.CO math-phmath.MPquant-ph
keywords geometrichyperplanesshalltimesveldkamplinesmathcalproperties
0
0 comments X
read the original abstract

Let $S_{(N)} \equiv PG(1,\,2) \times PG(1,\,2) \times \cdots \times PG(1,\,2)$ be a Segre variety that is $N$-fold direct product of projective lines of size three. Given two geometric hyperplanes $H'$ and $H''$ of $S_{(N)}$, let us call the triple $\{H', H'', \overline{H' \Delta H''}\}$ the Veldkamp line of $S_{(N)}$. We shall demonstrate, for the sequence $2 \leq N \leq 4$, that the properties of geometric hyperplanes of $S_{(N)}$ are fully encoded in the properties of Veldkamp {\it lines} of $S_{(N-1)}$. Using this property, a complete classification of all types of geometric hyperplanes of $S_{(4)}$ is provided. Employing the fact that, for $2 \leq N \leq 4$, the (ordinary part of) Veldkamp space of $S_{(N)}$ is $PG(2^N-1,2)$, we shall further describe which types of geometric hyperplanes of $S_{(N)}$ lie on a certain hyperbolic quadric $\mathcal{Q}_0^+(2^N-1,2) \subset PG(2^N-1,2)$ that contains the $S_{(N)}$ and is invariant under its stabilizer group; in the $N=4$ case we shall also single out those of them that correspond, via the Lagrangian Grassmannian of type $LG(4,8)$, to the set of 2295 maximal subspaces of the symplectic polar space $\mathcal{W}(7,2)$.

This paper has not been read by Pith yet.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.