Pith. sign in

REVIEW

Limited Data, Unlimited Potential: A Study on ViTs Augmented by Masked Autoencoders

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2310.20704 v2 pith:THSEX35Q submitted 2023-10-31 cs.CV cs.AI

classification cs.CVcs.AI
keywords vitsdatassatlimitedprimaryself-supervisedtasktasks
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

Vision Transformers (ViTs) have become ubiquitous in computer vision. Despite their success, ViTs lack inductive biases, which can make it difficult to train them with limited data. To address this challenge, prior studies suggest training ViTs with self-supervised learning (SSL) and fine-tuning sequentially. However, we observe that jointly optimizing ViTs for the primary task and a Self-Supervised Auxiliary Task (SSAT) is surprisingly beneficial when the amount of training data is limited. We explore the appropriate SSL tasks that can be optimized alongside the primary task, the training schemes for these tasks, and the data scale at which they can be most effective. Our findings reveal that SSAT is a powerful technique that enables ViTs to leverage the unique characteristics of both the self-supervised and primary tasks, achieving better performance than typical ViTs pre-training with SSL and fine-tuning sequentially. Our experiments, conducted on 10 datasets, demonstrate that SSAT significantly improves ViT performance while reducing carbon footprint. We also confirm the effectiveness of SSAT in the video domain for deepfake detection, showcasing its generalizability. Our code is available at https://github.com/dominickrei/Limited-data-vits.

Discussion (0). Continue with ORCID to comment.

Pith tools