Pith. sign in

REVIEW

All-dielectric Metaphotonics for Advanced THz Control of Spins

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2504.17588 v1 pith:LTWRUIS7 submitted 2025-04-24 physics.optics cond-mat.mtrl-sci

All-dielectric Metaphotonics for Advanced THz Control of Spins

classification physics.optics cond-mat.mtrl-sci
keywords spinscontroladvancedall-dielectricfieldenergymetaphotonicsmetasurfaces
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
read the original abstract

While nearly single cycle THz pulse is conventionally accepted as the stimulus for the fastest and the most energy efficient control of spins in magnets, all-dielectric metasurfaces have been recently demonstrated to be the least dissipative mean to enhance and control the coupling of light to spins. All-dielectric metasurfaces for the THz control of spins hold great potential in the field of spintronics and related technologies, pushing the boundaries of speed and energy efficiency in spin-based information processing. Here we demonstrate such a metasurface for an advanced THz control of spins in a ferrimagnetic film of iron garnet. Structuring a nonmagnetic substrate one can force a THz electromagnetic field, otherwise described by plane waves, to acquire an out-of-plane magnetic field and thus enable arbitrary direction of the torque acting on spins in all three dimensions. Hence, metaphotonics opens up a plethora of opportunities for advanced control of spins at THz rates in many hot fields of contemporary science, including spintronics, magnonics and quantum computing.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.