Friction in nanoelectromechanical systems: Clamping loss in the GHz regime
classification
❄️ cond-mat.mtrl-sci
keywords
clampingdeviceselasticenergyfrequencyfrictionlossnanoelectromechanical
read the original abstract
The performance of a wide variety of ultra-sensitive devices employing nanoelectromechanical resonators is determined by their mechanical quality factor, yet energy dissipation in these systems remains poorly understood. Here we develop a comprehensive theory of friction in high frequency resonators caused by the radiation of elastic energy into the support substrate, referred to as clamping loss. The elastic radiation rate is found to be a strong increasing function of resonator frequency, and we argue that this mechanism will play an important role in future microwave-frequency devices.
This paper has not been read by Pith yet.
discussion (0)
Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.