Pith. sign in

REVIEW 1 cited by

EntQA: Entity Linking as Question Answering

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2110.02369 v2 pith:ZXET6W5D submitted 2021-10-05 cs.CL cs.LG

classification cs.CLcs.LG
keywords entityentqalinkingansweringapproachentitiesmentionsquestion
verification ladder T0 review T1 audit T2 compute T3 formal

Signed reviews

No signed human review yet.

0 comments
read the original abstract

A conventional approach to entity linking is to first find mentions in a given document and then infer their underlying entities in the knowledge base. A well-known limitation of this approach is that it requires finding mentions without knowing their entities, which is unnatural and difficult. We present a new model that does not suffer from this limitation called EntQA, which stands for Entity linking as Question Answering. EntQA first proposes candidate entities with a fast retrieval module, and then scrutinizes the document to find mentions of each candidate with a powerful reader module. Our approach combines progress in entity linking with that in open-domain question answering and capitalizes on pretrained models for dense entity retrieval and reading comprehension. Unlike in previous works, we do not rely on a mention-candidates dictionary or large-scale weak supervision. EntQA achieves strong results on the GERBIL benchmarking platform.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Evaluation of LLMs on Long-tail Entity Linking in Historical Documents

    cs.CL 2025-05 conditional novelty 4.0 of 10

    GPT-3.5 and Llama-3-70B recall about 59-60% of long-tail historical entities versus ReLiK's 45.7%, but their lower precision leaves F1 scores near 53 versus ReLiK's 56.1.

Pith tools