Pith. sign in

REVIEW 3 cited by

RepViT: Revisiting Mobile CNN From ViT Perspective

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2307.09283 v8 pith:47PLXNJG submitted 2023-07-18 cs.CV

RepViT: Revisiting Mobile CNN From ViT Perspective

classification cs.CV
keywords lightweightrepvitcnnsvitslatencymobilearchitecturaldesigns
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
Share X Bluesky LinkedIn Reddit HN
read the original abstract

Recently, lightweight Vision Transformers (ViTs) demonstrate superior performance and lower latency, compared with lightweight Convolutional Neural Networks (CNNs), on resource-constrained mobile devices. Researchers have discovered many structural connections between lightweight ViTs and lightweight CNNs. However, the notable architectural disparities in the block structure, macro, and micro designs between them have not been adequately examined. In this study, we revisit the efficient design of lightweight CNNs from ViT perspective and emphasize their promising prospect for mobile devices. Specifically, we incrementally enhance the mobile-friendliness of a standard lightweight CNN, \ie, MobileNetV3, by integrating the efficient architectural designs of lightweight ViTs. This ends up with a new family of pure lightweight CNNs, namely RepViT. Extensive experiments show that RepViT outperforms existing state-of-the-art lightweight ViTs and exhibits favorable latency in various vision tasks. Notably, on ImageNet, RepViT achieves over 80\% top-1 accuracy with 1.0 ms latency on an iPhone 12, which is the first time for a lightweight model, to the best of our knowledge. Besides, when RepViT meets SAM, our RepViT-SAM can achieve nearly 10$\times$ faster inference than the advanced MobileSAM. Codes and models are available at \url{https://github.com/THU-MIG/RepViT}.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 3 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Scaling Parallel Sequence Models to Foundation-Scale Vision Encoders

    cs.CV 2026-05 unverdicted novelty 6.0

    C-GSPN scales 2D spatial propagation to foundation vision encoders via a fast CUDA kernel, compressed blocks, and two-stage distillation, matching ViT performance with 15% fewer parameters and 4x block speedup at 2K r...

  2. Accuracy Improvement of Cell Image Segmentation Using Feedback Former

    cs.CV 2024-08 unverdicted novelty 5.0

    Feedback Former improves cell image segmentation accuracy by feeding detailed feature maps back from near the output to lower transformer layers, outperforming non-feedback baselines with lower computational cost on t...

  3. Efficient Edge-Compatible CNN for Speckle-Based Material Recognition in Laser Cutting Systems

    cs.CV 2025-11 conditional novelty 4.0

    A 341k-parameter MobileNet-style CNN achieves 95.05% accuracy on the 59-class SensiCut speckle material recognition benchmark using single-channel green input.