Pith. sign in

REVIEW

Cell-Free Multi-User MIMO Equalization via In-Context Learning

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2404.05538 v2 pith:47EKOW7D submitted 2024-04-08 cs.IT cs.LGeess.SPmath.IT

classification cs.ITcs.LGeess.SPmath.IT
keywords equalizationlimitedmimotaskcapacitycell-freechanneldemonstrate
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Large pre-trained sequence models, such as transformers, excel as few-shot learners capable of in-context learning (ICL). In ICL, a model is trained to adapt its operation to a new task based on limited contextual information, typically in the form of a few training examples for the given task. Previous work has explored the use of ICL for channel equalization in single-user multi-input and multiple-output (MIMO) systems. In this work, we demonstrate that ICL can be also used to tackle the problem of multi-user equalization in cell-free MIMO systems with limited fronthaul capacity. In this scenario, a task is defined by channel statistics, signal-to-noise ratio, and modulation schemes. The context encompasses the users' pilot sequences, the corresponding quantized received signals, and the current received data signal. Different prompt design strategies are proposed and evaluated that encompass also large-scale fading and modulation information. Experiments demonstrate that ICL-based equalization provides estimates with lower mean squared error as compared to the linear minimum mean squared error equalizer, especially in the presence of limited fronthaul capacity and pilot contamination.

Discussion (0). Continue with ORCID to comment.

Pith tools