Pith. sign in

REVIEW 1 cited by

Tree of Reviews: A Tree-based Dynamic Iterative Retrieval Framework for Multi-hop Question Answering

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2404.14464 v1 pith:XLEF3YUT submitted 2024-04-22 cs.CL cs.AIcs.IR

classification cs.CLcs.AIcs.IR
keywords reasoningquestionansweringmulti-hopparagraphsretrievalchainframework
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Multi-hop question answering is a knowledge-intensive complex problem. Large Language Models (LLMs) use their Chain of Thoughts (CoT) capability to reason complex problems step by step, and retrieval-augmentation can effectively alleviate factual errors caused by outdated and unknown knowledge in LLMs. Recent works have introduced retrieval-augmentation in the CoT reasoning to solve multi-hop question answering. However, these chain methods have the following problems: 1) Retrieved irrelevant paragraphs may mislead the reasoning; 2) An error in the chain structure may lead to a cascade of errors. In this paper, we propose a dynamic retrieval framework called Tree of Reviews (ToR), where the root node is the question, and the other nodes are paragraphs from retrieval, extending different reasoning paths from the root node to other nodes. Our framework dynamically decides to initiate a new search, reject, or accept based on the paragraphs on the reasoning paths. Compared to related work, we introduce a tree structure to handle each retrieved paragraph separately, alleviating the misleading effect of irrelevant paragraphs on the reasoning path; the diversity of reasoning path extension reduces the impact of a single reasoning error on the whole. We conducted experiments on three different multi-hop question answering datasets. The results show that compared to the baseline methods, ToR achieves state-of-the-art performance in both retrieval and response generation. In addition, we propose two tree-based search optimization strategies, pruning and effective expansion, to reduce time overhead and increase the diversity of path extension. We will release our code.

Discussion (0). Sign in to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Beyond Independent Passages: Adaptive Passage Combination Retrieval for Retrieval Augmented Open-Domain Question Answering

    cs.CL 2025-07 conditional novelty 5.0 of 10

    AdaPCR jointly retrieves and reranks passage pairs for open-domain QA, showing small EM/F1 gains over an in-context retrieval baseline, mostly on multi-hop HotpotQA.

Pith tools