Pith. sign in

REVIEW 1 cited by

Fourfold Anisotropic Magnetoresistance and Unconventional Critical Exponents in Twinned FePd$_2$Te$_2$

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2411.15842 v1 pith:TG7PLEMY submitted 2024-11-24 cond-mat.mtrl-sci cond-mat.str-el

classification cond-mat.mtrl-scicond-mat.str-el
keywords fepdmagneticpropertiestwinscrystaleffectsymmetryanisotropic
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
abstract

As a special material symmetry operation, crystal twins usually influence physical properties. Here, detailed electrical transport and magnetic measurements were performed to reveal twinning effect on properties of van der Waals ferromagnet FePd$_2$Te$_2$. Orthorhombic crystal domains were observed in polarized optical microscopy and fixed $\pi$/2 angle between adjacent domains suggests a phase transition origin of the twins. FePd$_2$Te$_2$ exhibits fourfold in-plane anisotropic magnetoresistance. It is attributed to antiferromagnetic coupling component near atomically flat twin boundary and pseudo four-fold symmetry from perpendicular Fe chains. Intense magnetic domain motion is suggested by Hopkinson effect observed in magnetic susceptibility. A set of unusual critical exponents $\beta$ = 0.866, $\gamma$ = 1.043, $\delta$ = 2.20 cannot be classified in any universal class predicted by renormalized group. Deviation from standard model reflects the non-saturating magnetization and slow growth of spontaneous magnetization resulting from crystal domain walls. These results show that additional symmetry from twins and twin boundary have a significant effect on electrical transport and magnetic properties of FePd$_2$Te$_2$. There is much room to modulate physical properties of twinned van der Waals ferromagnets through twins.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Atomic to mesoscale hierarchical structures and magnetic states in an anisotropic layered ferromagnet FePd2Te2

    cond-mat.mtrl-sci 2025-06 conditional novelty 6.0 of 10

    Microscope images show that twinning domains in FePd2Te2 create compressed and stretched regions with different magnetic responses, including a polarized paramagnetic state above the ordering temperature.

Pith tools