Pith. sign in

REVIEW 1 cited by

Spin density wave and van Hove singularity in the kagome metal CeTi3Bi4

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2412.10286 v2 pith:6KHXGRXL submitted 2024-12-13 cond-mat.str-el cond-mat.mtrl-sci

Spin density wave and van Hove singularity in the kagome metal CeTi3Bi4

classification cond-mat.str-el cond-mat.mtrl-sci
keywords kagomemagnetichoveelectronicspin-densitywavemetalsphase
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
Share X Bluesky LinkedIn Reddit HN
read the original abstract

Kagome metals with van Hove singularities near the Fermi level can host intriguing quantum phenomena such as chiral loop currents, electronic nematicity, and unconventional superconductivity. However, to our best knowledge, unconventional magnetic states driven by van Hove singularities--like spin-density waves--have not been observed experimentally in kagome metals. Here, we report the magnetic and electronic structure of the layered kagome metal CeTi3Bi4, where Ti kagome electronic structure interacts with a magnetic sublattice of Ce3+ Jeff = 1/2 moments. Neutron diffraction reveals an incommensurate spin-density wave ground state of the Ce3+ moments, coexisting with commensurate antiferromagnetic order across most of the temperature-field phase diagram. The commensurate component is preferentially suppressed by thermal fluctuations and magnetic field, yielding a rich phase diagram involving an intermediate single-Q spin-density wave phase. First-principles calculations and angle-resolved photoemission spectroscopy identify van Hove singularities near the Fermi level, with the observed magnetic propagation vectors connecting their high density of states, strongly suggesting a van Hove singularity-assisted spin-density wave. These findings establish kagome metals LnTi3Bi4 as a model platform where the characteristic electronic structure of the kagome lattice plays a pivotal role in magnetic order.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Tunable bifurcation of magnetic anisotropy and bi-oriented antiferromagnetic order in kagome metal GdTi3Bi4

    cond-mat.str-el 2026-04 unverdicted novelty 6.0

    GdTi3Bi4 shows a tunable bifurcation of in-plane magnetic anisotropy at 2 K into two 7-degree-offset orientations, revealing hidden bi-oriented AFM order and three distinct domain phases under transverse magnetic fields.