Pith. sign in

REVIEW 5 cited by

Discovery of a likely Type II SN at z=3.6 with JWST

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2501.05513 v2 pith:KODGJHJJ submitted 2025-01-09 astro-ph.HE astro-ph.GA

Discovery of a likely Type II SN at z=3.6 with JWST

classification astro-ph.HE astro-ph.GA
keywords adsvjwstfirstlikelyredshifttransientdeepdiscovered
verification ladder T0 review T1 audit T2 compute T3 formal T4 reserved
0 comments
Share X Bluesky LinkedIn Reddit HN
read the original abstract

Transient astronomy in the early, high-redshift (z > 3) Universe is an unexplored regime that offers the possibility of probing the first stars and the Epoch of Reionization. During Cycles 1 and 2 of the James Webb Space Telescope (JWST), the JWST Advanced Deep Extragalactic Survey (JADES) program enabled one of the first searches for transients in deep images (~30 AB mag) over a relatively wide area (25 arcmin^2). One transient, AT 2023adsv, was discovered with an F200W magnitude of 28.04 AB mag, and subsequent JWST observations revealed that the transient is a likely supernova (SN) in a host with z_spec = 3.613 +/- 0.001 and an inferred metallicity at the position of the SN of Z_* = 0.3 +/- 0.1 Z_{\odot}. At this redshift, the first detections in F115W and F150W show that AT 2023adsv had bright rest-frame ultraviolet flux at the time of discovery. The multi-band light curve of AT 2023adsv is best matched by a template of an SN IIP with a peak absolute magnitude of M_B ~ -18.3 AB mag. We find a good match to a 20 M_{\odot} red supergiant progenitor star with an explosion energy of 2.0x10^51 ergs, likely higher than normally observed in the local Universe, but consistent with SNe IIP drawn from local, lower metallicity environments. AT 2023adsv is the most distant photometrically classified SN IIP yet discovered with a spectroscopic redshift measurement, and may represent a global shift in SNe IIP properties as a function of redshift.

discussion (0)

Sign in with ORCID, Apple, or X to comment. Anyone can read and Pith papers without signing in.

Forward citations

Cited by 5 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Discovery and Analysis of a Type II Supernova Candidate at z = 3.19 from JWST's COSMOS-Web Survey

    astro-ph.HE 2026-05 conditional novelty 7.0

    SN 2023aeaf is photometrically classified as a likely Type II supernova at z=3.195, consistent with a 12 solar mass progenitor and low-metallicity star-forming host.

  2. Expanding the High-z Supernova Frontier: "Wide-Area" JWST Discoveries from the First Two Years of COSMOS-Web

    astro-ph.HE 2026-01 unverdicted novelty 7.0

    JWST difference imaging from COSMOS-Web and PRIMER has yielded 68 high-redshift supernovae including a core-collapse event at z>3 and a Type Ia at z>2, demonstrating the feasibility of wide-area time-domain searches i...

  3. SN 2025ogs: A Spectroscopically-Normal Type Ia Supernova at z = 2 as a Benchmark for Redshift Evolution

    astro-ph.CO 2025-12 unverdicted novelty 7.0

    SN 2025ogs is a spectroscopically normal Type Ia supernova at z=2.05 whose luminosity distance and properties are consistent with low-z standards and current LambdaCDM constraints.

  4. A Type Ia Supernova Candidate at $z\sim4.3$: A Transient Interloper in the Search for $z\sim14$ Galaxies

    astro-ph.HE 2026-07 conditional novelty 6.0

    A JWST candidate z~14 galaxy is reclassified as a Type Ia supernova at z~4.3, implying SN Ia minimum delay times shorter than 1 Gyr.

  5. Surrogate models for type II supernovae: Probing low-energy explosions and interaction-free regimes

    astro-ph.SR 2026-07 conditional novelty 5.0

    Trained on STELLA grids, two autoencoder-plus-emulator surrogates reconstruct type II SN SEDs at ~1e-4 MSE and recover progenitor masses for SN 2005cs, SN 2012aw, and SN 1999em in minutes.