Pith. sign in

REVIEW 3 major objections 5 minor 12 references

Principled Out-of-Distribution Generalization via Simplicity

T0 review · 3 major / 5 minor · reviewed 2026-08-07 · deepseek-v4-flash

Pith's one-line read The paper claims that out-of-distribution generalization under covariate shift is driven by a simplicity principle: among all parameters that fit the source data, the one that generalizes to the target is the simplest according to a…

desk verdict Solid conditional rate analysis for a regularized MLE under a simplicity oracle, but the paper's central claim that simplicity drives OOD generalization is assumed, not demonstrated, and the experiments don't test it. read the letter →

arxiv 2505.22622 v1 pith:7EOOKNNW submitted 2025-05-28 stat.ML cs.LGmath.STstat.TH

classification stat.MLcs.LGmath.STstat.TH MSC 62F1268T07
keywords out-of-distributiongeneralizationcovariateshiftsimplicityprincipleregularizedmaximumlikelihoodsamplecomplexitycompositionaldiffusionmodelsFisherinformation
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper sets out to show that out-of-distribution generalization under covariate shift is governed by a simplicity principle: when many parameters fit the source data equally well, the one that also performs on the target is the simplest according to a predefined complexity measure R(β). It analyzes the regularized maximum likelihood estimator that minimizes the empirical loss plus λR(β), and proves sharp sample-complexity bounds for recovering the simplest source-consistent parameter, at rate log(n)/n when the simplicity gap is constant and at rate $n^{{-1+2/(3τ)}}$ when the gap vanishes smoothly. A sympathetic reader would care because this turns a folk intuition about weight decay and Occam's razor into a formal statistical statement with explicit rates.

What carries the argument

The load-bearing object is the regularized MLE (1), with a convex, L-smooth simplicity measure R that satisfies R(0)=0. The argument runs through the source solution set BS, the source and target Fisher information matrices IS and IT, the simplicity gap Δ or the smoothness exponent τ, and concentration inequalities for the empirical loss, gradient, and Hessian. These ingredients let the proof show that any parameter with empirical regularized loss no worse than β⋆ must lie in a small ball around β⋆, and then Taylor-expand the target excess risk around β⋆.

What would settle it

Take a well-specified covariate-shift problem with two source-minimizing parameters, choose R so that the human-aligned target parameter has strictly larger R than a spurious alternative, and run the regularized MLE; if the estimator selects the spurious parameter with target excess risk bounded away from zero as n grows, the simplicity principle as stated is false for that metric.

Watch

Extended reading notes

Core claim

The paper's central claim is that the parameter β⋆ that generalizes to the target distribution is exactly the minimizer of the simplicity measure R over the set BS of source-domain minimizers, and that the regularized MLE defined in (1) recovers it. Theorem 4.1 bounds the target excess risk by Tr(IT $IS^{{-1}}$) log n/n plus a term controlled by the alignment of ∇R(β⋆) with the Fisher geometry and by the inverse square of the simplicity gap Δ. Theorem 4.2 replaces the inverse with the pseudoinverse and the fixed gap with a smoothness condition (Assumption C.3), yielding rate $n^{{-1+2/(3τ)}}$. The empirical section supports the premise by showing that diffusion models generate unseen attribute combinations and that MLPs trained to fit the source with non-generalizable target maps have larger summed squared weights than the identity solution.

Load-bearing premise

Everything rests on the premise that the target-generalizing parameter really is the simplest among all parameters that fit the source well; the theorems assume this rather than deriving it from data or architecture.

Editorial extensions

If this is right

  • With a constant simplicity gap, the regularized MLE attains excess risk O(log n/n), matching the classical rate of well-specified estimation when there is no covariate shift.
  • In degenerate directions where the source Fisher information is singular, the pseudoinverse bound shows the regularizer selects the simplest parameter in the null space, so the target can still be learned even though source data alone is silent there.
  • In the vanishing-gap case, the rate is n^{-1+2/(3τ)}; as τ increases, it approaches the constant-gap rate, so the two theorems interpolate smoothly.
  • When the source minimizer is unique (Δ = ∞), the bound reduces to the known minimax-optimal MLE result, showing the simplicity framework is a strict generalization.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • A direct test of the theory would vary the regularization weight λ in a synthetic covariate-shift problem with multiple source-consistent models and check that the target excess risk follows the predicted log(n)/n and n^{-1+2/(3τ)} curves.
  • The quotient-space remark suggests treating parameters equivalent under prediction and R as one class; formalizing Theorems 4.1 and 4.2 on the quotient Rd/~ would cover symmetric pairs like ±β in quadratic response models.
  • Because the theorem requires β⋆ to be R-minimal, the framework predicts that different choices of R (for instance squared ℓ2 versus group norms) select different generalization targets, which may explain why some pretraining biases transfer better than others.
  • A stricter empirical test of the premise would train multiple models only on source data and check that target failure correlates with higher R; the paper's non-generalizing models are instead produced with modified target labels.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 5 minor

Summary. The paper proposes that out-of-distribution (OOD) generalization in well-specified parametric models is governed by a simplicity principle: among all parameters that minimize the source-domain population loss, the unique target-generalizing parameter is the minimizer of a predefined simplicity metric R(·). The authors formalize this in a covariate-shift setting, study the regularized maximum likelihood estimator β̂_λ = argmin_β {ℓ_n(β) + λR(β)} (Eq. (1)), and give two non-asymptotic excess-risk bounds. Theorem 4.1 covers a constant simplicity gap Δ and yields O(log n / n) plus a regularization term of order ∥I_T^{1/2} I_S^{-1} ∇R(β⋆)∥² log n / (Δ² n). Theorem 4.2 covers a vanishing-gap regime with a smoothness condition C.3 and yields a rate n^{-1+2/(3τ)} using pseudoinverses. The empirical sections describe a diffusion-model image-generation experiment and an MLP toy task in which non-generalizing models trained with modified target data have larger squared weight norms than a model trained with source-only identity data. The appendix contains detailed proofs with explicit thresholds.

Significance. If taken as a conditional rate analysis, the paper is a solid contribution: the proofs are detailed and the rates are internally coherent, and the special case B_S = {β⋆} correctly recovers the known minimax MLE rate under covariate shift. The paper is also honest in disclosing a limitation in its final discussion, where the quadratic example y = (β⊤x)² violates Assumption C.3 due to the sign symmetry. However, the paper's central scientific claim — that simplicity explains OOD generalization — is not established by the theorems or the experiments. The theorems assume that β⋆ is the R-minimizer over the source solution set; the experiments never test whether a source-only regularized estimator selects that R-minimizer, and the diffusion experiment provides no measurement of R at all. Thus the contribution is best assessed as a conditional theory of regularization-based model selection under a simplicity oracle, not as evidence for the empirical thesis stated in the abstract and introduction.

major comments (3)
  1. [Section 4.1, Eq. (1); Section 3.2; Appendix B.3–B.5] The load-bearing premise β⋆ = argmin_{β∈B_S} R(β) is assumed, not demonstrated. Theorems 4.1 and 4.2 show that the regularized MLE recovers this β⋆ under Assumptions A–C, but they do not establish that the R-minimizer is the model selected by practical training or that R-minimization among source-only fits corresponds to human-aligned generalization. The MLP experiments train non-generalizing alternatives on the 400 source identity samples plus 400 modified target samples (Appendix B.3–B.5), so those alternatives are not plausible outputs of Eq. (1) trained on source data alone. The observed larger squared norms show that fitting different target labels raises the norm; they do not show that among models that all fit the source distribution the identity solution is the unique R-minimizer, nor that solving Eq. (1) with source-only data selects it. The diffusion experiment of Section 3.1 reports no measurement of R at all. To support the paper's stated claim, the authors should either add experiments that fit Eq. (1) on source-only data with various λ and test whether the selected solution is the target-generalizing one, or explicitly re-scope the paper as a conditional theoretical framework.
  2. [Abstract and Section 4, Theorems 4.1–4.2] The claim of 'sharp sample complexity guarantees' is stronger than what is proven. The theorems are upper bounds on the excess risk of the regularized MLE; there is no matching lower bound for the multi-minimizer simplicity setting. The recovery of Ge et al.'s minimax rate in the special case B_S = {β⋆} shows that the first term is optimal in that restricted setting, but it does not certify the dependence on Δ, τ, or the alignment term ∥I_T^{1/2} I_S^{-1}∇R(β⋆)∥². The paper should either add a lower bound for the regularized estimator's risk in the simplicity-gap model or temper the 'sharp' wording to 'upper bounds that recover the known minimax rate in the singleton case.'
  3. [Section 4.3 and 'Discussion on equivalence classes' (end of Section 5)] The paper's own example y = (β⊤x)² with β⋆ = (0, β⋆_{-1}) shows that Assumption C.3 fails in a basic well-specified model: −β⋆ belongs to B_S, R(−β⋆) = R(β⋆), yet ∥β⋆ − (−β⋆)∥₂ = 2∥β⋆∥₂ ≠ 0. The authors state that a quotient-space extension should restore the result but leave it to future work. This is a nontrivial limitation, not a cosmetic one, because predictive symmetries are common and the theorem's excess-risk claims are formally restricted to settings where C.3 holds. The manuscript should either provide the quotient-space version of Theorems 4.1 and 4.2 or clearly state in the main text that the results apply only when the simplicity metric separates all predictively equivalent parameters.
minor comments (5)
  1. [Section 4.1] The symbol B_S is used both for the solution set argmin_β E_S[ℓ(x,y,β)] and, immediately after, for the scalar bound max_{β∈B_S} ∥β∥₂. This overloading makes the proofs harder to read; use a different symbol such as B̄_S for the scalar.
  2. [Section 4.2] The sentence 'Assumption B.2 guarantees that the true model is the simpler than all source-compatible candidates' has a grammatical error and should read 'is simpler than all source-compatible candidates.'
  3. [Appendix A.1] In the description of test-image generation, the text says 'the RGB values in training images with labels [fg-color] = 0 and [fg-color] = 1' where it should refer to test images; similarly for the radius sentence.
  4. [References] The reference list contains duplicate entries for Dhariwal and Nichol (2021a/b) and Ho et al. (2020a/b), and 'Chadrasekaran' is a typo for 'Chandrasekaran.' These should be cleaned up.
  5. [Figure 2 and Appendix B] The box plots in Figure 2 are described only qualitatively. Reporting median and interquartile ranges of the squared Frobenius norms, and ideally the source-only training loss values, would make the comparison more informative and would help the reader judge whether the non-generalizing models are truly comparable source fits.

Circularity Check

1 steps flagged · score 6.0 of 10

The paper's central principle — simplicity selects the OOD-generalizing model — is the definition of β⋆, not a derived result; Theorems 4.1–4.2 are conditional rate analyses under that assumed oracle.

  1. self definitional [Section 1 (Intro) and Section 4.1, pre-theorem assumption]
    "We assume that the only generalizable parameter (i.e., the ground truth), denoted β⋆, satisfies β⋆ = arg minβ∈BS R(β), where BS denotes the set of all the minimizers on the source (i.e., training) domain. ... We posit that this true parameter corresponds to the “simplest” solution among all the source-domain minima, where “simplicity” is quantified by a measure denoted by R(β). Formally, we assume: β⋆ = arg minβ R(β) s.t. β ∈ arg minβ ES[ℓ(x, y, β)]."

    The headline contribution ('identification of simplicity as a key driver for OOD generalization') is encoded directly as the definition of β⋆. The regularized MLE in (1) is then shown, under Assumptions B.2/C.3, to recover this R-minimizer of BS; the proof (Lemma C.3, Lemma C.11) uses the assumed gap to reject spurious source minimizers. No independent step derives from architecture, data, or OOD performance that the target-correct parameter must be the R-minimizer. If a spurious β∈BS had smaller R, Theorems 4.1 and 4.2 would not apply and (1) would provably select the spurious model. Thus the prediction 'simplicity selects the generalizing model' is the input assumption, not an output of the derivation.

full rationale

The non-asymptotic rate analysis (Theorems 4.1 and 4.2 and Appendix C) is substantive and not circular: conditional on β⋆ being the R-minimizer of BS with the stated gap or smoothness conditions, the concentration and strong-convexity arguments are genuine mathematical content, and in the unique-minimizer limit the bound correctly reduces to the prior MLE rate. The circularity is at the level of the paper's central scientific claim: the abstract and contributions assert that simplicity 'typically corresponds' to the generalizing model and that this is 'revealed' by the analysis, whereas the formal setup simply assumes β⋆ = argmin_{BS} R. The empirical evidence in Section 3.2 does not test this load-bearing premise: non-generalizing models are trained on source identity samples plus modified target samples (Appendix B.3–B.5), so their larger R reflects the target corruption built into their construction, not a comparison among models that all fit source data alone. The diffusion experiment in Section 3.1 reports no measurement of R. The authors candidly flag a related limitation in the Section 5 discussion of equivalence classes (Assumption C.3 fails for y = (β⋆⊤x)² with β⋆ and −β⋆), which further shows the assumed simplicity geometry, rather than any derived principle, carries the result. The self-citation to Ge et al. (2023) for the unique-minimizer limit is legitimate and not load-bearing for the new claim; the same holds for the minimax-optimality remark.

Assumptions & free parameters 3 free parameters · 9 assumptions · 0 invented entities

The framework rests on the simplicity hypothesis (β⋆ = argmin R over BS) plus a stack of regularity conditions (A.1-A.4, B.1-B.2 or C.1-C.3). The simplicity metric R, the gap Δ, and the exponent τ are not fitted from data; they are model choices. This means the paper's contribution is a conditional rate analysis, not an explanation of where simplicity comes from or why real models satisfy it.

free parameters (3)
  • Simplicity metric R(β) = Squared Frobenius norm in experiments; arbitrary convex L-smooth R in theory
    The paper assumes a predefined R but does not give a data-driven way to choose it. The theorem holds for any convex L-smooth R, so the practical meaning of 'simplest model' depends entirely on this choice.
  • Simplicity gap Δ = Assumed >0 in B.2
    The constant-gap result requires a fixed positive gap between R(β⋆) and the next source-compatible model; the second term in Theorem 4.1 scales as 1/Δ^2.
  • Vanishing-gap exponent τ = Assumed τ ≥ 9 in C.3
    The rate n^{-1+2/(3τ)} is determined by this assumed exponent; it is not estimated from any experiment.
assumptions (9)
  • domain assumption Well-specified parametric model with covariate shift: p(y|x)=f(y|x;β⋆) and PS(Y|X)=PT(Y|X)
    Section 2 introduces this as the core statistical setup.
  • ad hoc to paper The true generalizing parameter β⋆ is the minimizer of R over the source minimizer set BS
    Section 4.1: β⋆ = arg min R(β) s.t. β ∈ arg min ES[ℓ]. This is the simplicity hypothesis and is assumed, not derived.
  • domain assumption Concentration inequalities (A.1) hold for loss, gradient, Hessian
    Assumption A.1 in Section 4.1; standard for bounded or light-tailed losses but stated as an assumption.
  • domain assumption Hessian Lipschitz (A.2)
    Assumption A.2; used throughout the Taylor expansions in proofs.
  • domain assumption A.3: a fixed gap G separates global minima from all other local minima and from the region outside a large ball
    Assumption A.3; needed to rule out spurious local minima in the proof of Lemmas C.2 and C.10.
  • domain assumption R is convex, L-smooth, and R(0)=0 (A.4)
    Assumption A.4; used to bound regularization terms via Lipschitz gradients.
  • domain assumption B.1: source population loss is α-strongly convex at every source minimizer
    Assumption B.1 in the constant-gap regime; ensures quadratic curvature around each solution.
  • domain assumption B.2: constant simplicity gap Δ>0
    Assumption B.2; central separation condition for Theorem 4.1.
  • domain assumption C.1-C.3: BS is a compact C1 submanifold, Hessian has rank d-dS, and simplicity-distance smoothness with exponent τ
    Assumption C in Section 4.3; used in the vanishing-gap proof.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Principled Out-of-Distribution Generalization via Simplicity." pith.science (2026). https://pith.science/paper/7EOOKNNW

@misc{pith2026250522622,
  author       = {Pith},
  title        = {Pith review of: Principled Out-of-Distribution Generalization via Simplicity},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/7EOOKNNW}},
  note         = {Machine review of arXiv:2505.22622}
}
read the original abstract

Modern foundation models exhibit remarkable out-of-distribution (OOD) generalization, solving tasks far beyond the support of their training data. However, the theoretical principles underpinning this phenomenon remain elusive. This paper investigates this problem by examining the compositional generalization abilities of diffusion models in image generation. Our analysis reveals that while neural network architectures are expressive enough to represent a wide range of models -- including many with undesirable behavior on OOD inputs -- the true, generalizable model that aligns with human expectations typically corresponds to the simplest among those consistent with the training data. Motivated by this observation, we develop a theoretical framework for OOD generalization via simplicity, quantified using a predefined simplicity metric. We analyze two key regimes: (1) the constant-gap setting, where the true model is strictly simpler than all spurious alternatives by a fixed gap, and (2) the vanishing-gap setting, where the fixed gap is replaced by a smoothness condition ensuring that models close in simplicity to the true model yield similar predictions. For both regimes, we study the regularized maximum likelihood estimator and establish the first sharp sample complexity guarantees for learning the true, generalizable, simple model.

Figures

Figures reproduced from arXiv: 2505.22622 by the authors.

Figure 1
Figure 1. Diffusion Model Image Generation Setting. [PITH_FULL_IMAGE:figures/full_fig_p005_1.png] view at source ↗
Figure 2
Figure 2. generalizable vs. non-generalizable model weights. (a) Sum of squared Frobenius norms of weights in models trained on uniform mappings. (b) Sum of squared Frobenius norms of weights in models trained on permutation mappings. (c) Sum of squared Frobenius norms for models trained on interpolations between the identity and flipped maps. Here, α = 0 corresponds to the identity map and α = 1 to the flipped map. In all th… view at source ↗
Figure 3
Figure 3. Diffusion Training. (a) Training loss (MSE) per epoch, averaged over all 200,000 training examples. (b) Test loss (MSE) per epoch for each test class, averaged over all 2,000 test examples per class. The final test loss after all 400 epochs is plotted in dashed lines, with numerical values 2.00398e-4, 1.46671e-4, 1.67488e-4, and 1.32801e-4. A.4 Computation Resources The experiments are conducted on a server using an… view at source ↗
Figures from the paper (4 more)
Figure 4
Figure 4. Figure 4: Identity Mapping Training: (a) Training loss (MSE) per epoch averaged over all ten runs, plotted for the first 20, 000 of 40, 000 total epochs; final training loss: 6.02663e-4. (b) Test loss (MSE) per epoch for each test class, averaged over all ten models. We restrict…
Figure 5
Figure 5. Figure 5: Uniform Mapping Training: (a) Histogram of training loss (MSE) in final epoch for all eighty trials. Training losses are averaged over ten independent models trained per trial. (b) An example of the training loss curve for a randomly selected trial averaged over all 10…
Figure 6
Figure 6. Figure 6: Permutation Mapping Training: (a) Histogram of training loss (MSE) in final epoch for all twenty trials. Training losses are averaged over ten independent models trained per trial. (b) An example of an average training loss curve for a randomly selected trial. (a) (b) …
Figure 7
Figure 7. Figure 7: Interpolation Mapping Training: (a) Plot of training loss (MSE) in final epoch for all eleven α. Training losses are averaged over ten independent models. Note that α = 0 corresponds to the identity map on {0, 1} 3 , while α = 1 corresponds to the flipped map. (b) An e…

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

12 extracted references · 12 canonical work pages

  1. [1]

    β0 is the minimizer of the population loss over D0 S, i.e., β0 = arg minβ∈D0 S ES[ℓ(x, y, β)]

  2. [2]

    (13) Thus, for any β ∈ B(β⋆, n−3/8), we have ˆL(β) − ˆL(β⋆) ≥ 1 2 (∆β − z)T IS(∆β − z) − 1 2 zT ISz − B2 r log n n n− 3 4 − B3 6 n− 9 8 . (14) (14) - (12) gives ˆL(β) − ˆL(β⋆ + z) ≥ 1 2 (∆β − z)T IS(∆β − z) − 2B2 r log n n + λL ! c Tr(I −1 S ) logn n + λ2 I −1 S ∇R(β⋆) 2 2 − 2B3 3 c Tr(I −1 S ) logn n 3/2 + λ3 I −1 S ∇R(β⋆) 3 2 ! − B2 r log n n n− 3 4 − B...

  3. [3]

    Since f is smooth, the first-order optimality condition implies that its directional derivative vanishes along directions in the tangent space: 2⟨β − β′, v⟩ = 0, ∀v ∈ T(β′)

    Then β′ minimizes f over BS, i.e., β′ = arg minx∈BS f (x). Since f is smooth, the first-order optimality condition implies that its directional derivative vanishes along directions in the tangent space: 2⟨β − β′, v⟩ = 0, ∀v ∈ T(β′). 35 Therefore, β − β′ ∈ T(β′)⊥. By Proposition C.6, we know T (β′) = null ES[∇2ℓ(x, y, β′)] , and thus T (β′)⊥ = col ES[∇2ℓ(x...

  4. [4]

    From Lemma C.9, we know that for all β ∈ ∂Ω, ES[ℓ(x, y, β)] > A(n)

    This means there existsβ ∈ Ω such that ES[ℓ(x, y, β)] ≤ A(n). From Lemma C.9, we know that for all β ∈ ∂Ω, ES[ℓ(x, y, β)] > A(n). This implies the existence of a local minimum of ES[ℓ(x, y, β)] in Ω. Let β′ ∈ Ω be such a local minimizer. We then observe: ES[ℓ(x, y, β′)] ≤ A(n) = ES[ℓ(x, y, β⋆)] + λR(β⋆) + 2B0 r log n n < ES[ℓ(x, y, β⋆)] + G, where the las...

  5. [5]

    As a result, as long as n ≥ cN ′ 3, we have ˆL(β) ≥ ˆL(β⋆)

    Combining (33) and (34), we have ˆL(β) > ˆL(β⋆) + λ 2 n−ϵ − c r Tr(IS) logn n c1n−δ(log n) 1 4 + n−ϵτ − B2 r log n n c1n−δ(log n) 1 4 + n−ϵτ 2 − B3 c1n−δ(log n) 1 4 + n−ϵτ 3 = ˆL(β⋆) + cλ 2 n−2δ−ϵp log n − c r Tr(IS) logn n c1n−δ(log n) 1 4 + n−ϵτ − B2 r log n n c1n−δ(log n) 1 4 + n−ϵτ 2 − B3 c1n−δ(log n) 1 4 + n−ϵτ 3 ≥ ˆL(β⋆) + cλ 2 n−2δ−ϵp log n − c r T...

  6. [6]

    In the sequel, we denote ˆβ0 λ := arg minβ∈D0 S ℓn(β) + λR(β)

    The function ES[ℓ(x, y, β)] is α 2 -strongly convex over D0 S. In the sequel, we denote ˆβ0 λ := arg minβ∈D0 S ℓn(β) + λR(β). 41 Recall: IS := IS(β⋆), IT := IT (β⋆), α1 := B1∥I † S∥1/2 2 , α2 := B2∥I † S∥2, α3 := B3∥I † S∥3/2 2 , κ := Tr(IT I † S) ∥I 1 2 T I † SI 1 2 T ∥2 , ˜κ := Tr(I † S) ∥I † S∥2 . Following the same reasoning as in (19) and (21) from t...

  7. [7]

    Here C(n, Id) = c r Tr(IS) logn n + B1 logγ B1p Tr(IS) ! · log n n

    Then, for all β, it holds that |(ES[ℓ(x, y, β)] − ℓn(β)) − (ES[ℓ(x, y, β0)] − ℓn(β0))| ≤ min ( 2B0 r log n n , C(n, Id) ∥β − β0∥2 + B2 r log n n ∥β − β0∥2 2 + B3 ∥β − β0∥3 2 ) . Here C(n, Id) = c r Tr(IS) logn n + B1 logγ B1p Tr(IS) ! · log n n . Proof of Proposition C.15. Note that by Proposition C.14, for all β: |(ES[ℓ(x, y, β)] − ℓn(β)) − (ES[ℓ(x, y, β...

  8. [8]

    Thus, we finish the proofs

    Moreover, we have |(ES[ℓ(x, y, β)] − ℓn(β)) − (ES[ℓ(x, y, β0)] − ℓn(β0))| ≤ |ES[ℓ(x, y, β)] − ℓn(β)| + |ES[ℓ(x, y, β0)] − ℓn(β0)| ≤ 2B0 r log n n . Thus, we finish the proofs. We now proceed to establish the following lemma. Lemma C.16. Suppose n ≥ N ′

Show all 12 references
  1. [9]

    Here D′′ := 8 α (C(n, Id) + λL∥β0∥2)

    Then, for all β ∈ D0 S \ B(β0, D′′), we have ˆL(β) > ˆL(β0). Here D′′ := 8 α (C(n, Id) + λL∥β0∥2) . (42) 46 Proof of Lemma C.16. For any β ∈ D0 S, we have ˆL(β) = ℓn(β) + λR(β) = ES[ℓ(x, y, β)] + ℓn(β) − ES[ℓ(x, y, β)] + λR(β) ≥ ES[ℓ(x, y, β0)] + α 4 ∥β − β0∥2 2 + ℓn(β) − ES[ℓ...

  2. [10]

    (50) Thus, for any β ∈ D0 S ∩ B(β0, n−3/8), we have ˆL(β) − ˆL(β0) ≥ 1 2 (∆β − z)T I 0 S(∆β − z) − 1 2 zT I 0 Sz − B2n− 7 6 − cλLn− 7 6 + 1 3τ − B3 6 n− 9 8 . (51) (51) - (49) gives ˆL(β) − ˆL(β0 + z) ≥ 1 2 (∆β − z)T I 0 S(∆β − z) − 2B2 r log n n + 3λL ! c Tr(I † S) logn n + λ...

  3. [11]

    It then holds that ∥∆β∥2 ≤ 2  c s Tr(I † S) logn n + λ I † S∇R(β⋆) 2   ≤ n−3/8, Here, the last inequality holds as long as n ≥ N ′

  4. [12]

    Recall that by Lemma C.16, we have ˆβλ ∈ D0 S ∩ B(β0, D′′) ⊂ D0 S ∩ B(β0, n−3/8)

    In other words, we show that D ⊂ D0 S ∩ B(β0, n−3/8). Recall that by Lemma C.16, we have ˆβλ ∈ D0 S ∩ B(β0, D′′) ⊂ D0 S ∩ B(β0, n−3/8). Also, for any β ∈ D0 S∩ ∈ B(β0, n−3/8) ∩ DC, we have ˆL(β) − ˆL(β0 + z) > 0. Consequently, we conclude ˆβ0 λ ∈ D0 S ∩ B(β0, D′′) ∩ D. By the ...

Pith tools

Reviewed August 7, 2026 · model on record in the stance chip above.