Pith. sign in

REVIEW 3 major objections 3 minor 66 references

Non-Markovian escape under stochastic resetting

T0 review · 3 major / 3 minor · reviewed 2026-08-04 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read Resetting erases the memory of a non-Markovian particle, turning its heavy-tailed escape distribution into a near-exponential one and enabling an optimal reset rate for fast escape.

desk verdict Real FPE derivation and position statistics, but Eq. (11) is not a survival probability—the FPT/MFPT claims don't hold as written. read the letter →

arxiv 2509.11608 v2 pith:HMX5TD3X submitted 2025-09-15 cond-mat.stat-mech cond-mat.soft

Debasish Saha , Rati Sharma This is my paper · ORCID
classification cond-mat.stat-mechcond-mat.soft MSC 82C3160G2260J70 PACS 05.40.-a05.10.Gg
keywords stochasticresettingnon-Markoviandynamicsfirst-passagetimefractionalGaussiannoisegeneralizedLangevinequationMittag-Lefflerrelaxationescapekineticsoptimalresetrate
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper studies a harmonically trapped overdamped particle driven by fractional Gaussian noise, a memory-carrying noise with power-law correlations, and asks what Poissonian stochastic resetting does to escape over an absorbing boundary. It builds an analytical framework by combining a time-local Fokker-Planck equation with a time-dependent diffusion coefficient, a Gaussian propagator with Mittag-Leffler relaxation, and a renewal equation that stitches together intervals between resets. The central claim is that resetting breaks the memory: the first-passage time distribution, which without resetting has a heavy non-exponential tail, becomes near-exponential once resetting is introduced, and an optimal reset rate minimizes the mean escape time when the reset point is away from the well minimum. A sympathetic reader would care because this gives a concrete, closed-form prescription for accelerating escape in viscoelastic and other memory-driven environments, and identifies resetting as a control that effectively erases temporal correlations.

What carries the argument

The central machinery is the renewal equation P(x,t|x0) = e^{-rt}G(x,t|x0) + r ∫_0^t dτ e^{-rτ}G(x,τ|x_r), which is exact for Poissonian resetting because reset times are independent of the system dynamics. It is coupled to the Fokker-Planck equation with time-dependent coefficient eta(t) = -d/dt ln chi(t), where chi(t) = E_b[-(t/tau_0)^b] is the Mittag-Leffler relaxation function; this is the object that carries the memory of the non-Markovian process. The Gaussian propagator constructed from this FPE is then integrated up to the absorbing boundary to produce survival and first-passage statistics. The machinery works by turning the non-Markovian memory into a single time-dependent coefficie

What would settle it

Run direct numerical integration of the original generalized Langevin equation (with power-law kernel and fractional Gaussian noise) in the same harmonic well with an absorbing boundary at x_a, collect a large number of first-passage times at a fixed reset rate r, and compare the empirical survival probability with Eq. (11). A statistically significant deviation in the exponential tail or in the location of the MFPT-vs-r minimum would falsify the exact Markovianization claim.

Watch

Extended reading notes

Core claim

For a linear restoring force and fractional Gaussian noise with Hurst index H in [1/2,1), the paper claims that the non-Markovian generalized Langevin equation can be reduced to a Fokker-Planck equation with a time-dependent diffusion coefficient eta(t) = -d/dt ln chi(t), where chi(t) is a Mittag-Leffler relaxation function. The corresponding propagator is Gaussian, and combining it with a renewal equation for Poissonian resetting yields closed-form survival probabilities and first-passage time distributions. The central discovery is that resetting induces Markovianity: the heavy-tailed, non-exponential first-passage distribution becomes near-exponential, with an optimal reset rate that mini

Load-bearing premise

The load-bearing premise is that the non-Markovian generalized Langevin dynamics with fractional Gaussian noise in a harmonic well is exactly equivalent to a time-local Fokker-Planck equation whose only memory trace is the time-dependent coefficient eta(t); if residual non-local memory survives at an absorbing boundary, the renewal-based escape statistics are approximations.

Editorial extensions

If this is right

  • If the central claim holds, resetting is a practical control strategy: one tunable rate r can convert slow heavy-tailed escape into a Poisson-like fast escape in viscoelastic and other memory-driven environments.
  • The optimal reset rate is not universal: it increases with memory strength H, so strongly correlated baths need more frequent restarts, while weakly correlated baths need only occasional resets.
  • Resetting at the harmonic well minimum is counterproductive and can increase mean escape time; reset positions away from the minimum are required for the speed-up.
  • The survival formula with the Gaussian propagator provides closed-form first-passage statistics that can be used to fit single-molecule escape experiments in memory-driven systems.
  • Direct numerical simulation of the generalized Langevin equation confirms the analytical renewal formulas for position distributions and first-passage time histograms over the parameter range studied.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • A direct test the paper does not run: simulate the original generalized Langevin equation with an absorbing boundary, collect first-passage times, and compare the empirical survival probability with Eq. (11); this would settle whether any non-local memory survives the reset at the absorbing boundary.
  • The exact Markovianization likely depends on the harmonic force. A testable extension is to apply the same resetting protocol to an anharmonic or bistable well and check whether the first-passage distribution remains exponential; the FPE reduction would need modification there.
  • The paper's MFPT figures are based on integrating survival over a finite time window, which the paper itself notes is 'analogous' rather than exact; an exact tail extrapolation might shift the reported optimal reset rates.
  • The renewal equation's exactness relies on Poissonian reset times. An extension not pursued in the paper is whether periodic or power-law reset schedules preserve the memory-erasing effect or produce different optimal rates.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

3 major / 3 minor

Summary. The paper studies first-passage escape from a harmonic well for an overdamped generalized Langevin equation driven by fractional Gaussian noise, under Poissonian stochastic resetting. It derives a Fokker-Planck equation for the one-point density, solves the full-space propagator with a Mittag-Leffler relaxation function, uses a renewal equation to obtain the resetting steady state, and then defines the survival probability as the integral of this unrestricted propagator over the region left of an absorbing boundary. From this it extracts a first-passage-time distribution and a mean first-passage time, reporting an exponential tail induced by resetting and an optimal reset rate. The position-distribution part is supported by simulations, and code is provided. The central first-passage claim, however, is based on an incorrect identification of occupancy with survival.

Significance. If the first-passage analysis were correct, the paper would provide a useful closed-form treatment of resetting in a non-Markovian harmonic system, with practical implications for escape kinetics and optimal reset protocols. The paper has genuine strengths: the derivation of the time-local FPE for the marginal density is non-trivial, the full-space propagator is explicit, the renewal construction for the position distribution is standard, and the simulations are reproduced with shared code. These strengths, however, do not rescue the FPT claims, because the quantity computed as survival is not the survival probability of a process with an absorbing boundary. The central quantitative results in Figs. 3--5 are therefore not established.

major comments (3)
  1. [Section II, Eqs. (5), (6), (7), (11)] The object S(t|x0) defined in Eq. (5) and evaluated in Eq. (11) is not a survival probability. It is the integral over x<x_a of the full-space, no-absorbing-boundary propagator P(x,t|x0) from Eq. (8). That is the probability that the process is to the left of x_a at time t; it does not condition on the trajectory never having hit x_a. A true survival probability requires solving the FPE on the half-line with P(x_a,t)=0, or using the renewal relation S_r(t)=e^{-rt} S_0(t)+r∫_0^t dτ e^{-rτ} S_0(τ) S_r(t-τ) with S_0 the true no-reset survival probability. Eq. (11a) contains neither ingredient. Consequently f(t)=-dS/dt in Eq. (6) is not a first-passage-time density and Eq. (7) is not the MFPT. This is the load-bearing step of the paper.
  2. [Eq. (11b) and Markovian limit H=1/2] The defect is visible already in the model's own Markovian limit. For H=1/2, χ(t)=e^{-t/τ_0}. From Eq. (11b), S∞ = (1/2)[1+erf(x_a√(mω²/(2k_BT)))] (for x_0=0), which is positive for any finite absorbing boundary. Thus f(t) has total mass 1-S∞<1, and the integral in Eq. (7) diverges because S(t) tends to a positive constant. The paper's finite-time integration in Fig. 5, and the text's admission that the result is 'not the exact MFPT', cannot cure a positive tail. This directly contradicts the assumption S(∞)=0 used in Eq. (7). The issue is not a numerical truncation; the computed object is defective as a first-passage distribution.
  3. [Fig. 4 and Appendix C] The FPT simulations in Appendix C use an absorbing boundary at x=x_a and stop trajectories at the first hitting time. That is the correct protocol for first-passage statistics. The analytical curve in Fig. 4, however, is derived from the derivative of the unrestricted-propagator quantity in Eq. (11). These two objects are not the same: the analytical density is defective in the sense described above, whereas the simulated histogram is a genuine first-passage-time density. Therefore Fig. 4 cannot validate Eq. (11). The reported agreement is unexplained and, as a matter of principle, cannot hold in the tail region. This invalidates the paper's main comparison and the claims of exponential-tail and optimal-reset behavior in Figs. 3--5.
minor comments (3)
  1. [Appendix D, Eq. (D33)] In the second term of the expression for I', the Laplace transform should be \(\bar K(z_2)\), not \(\bar K(z_1)\); the subsequent formula appears to use the corrected version. Please fix the typo.
  2. [Appendix D and main text] The notation mω²_B appears with a subscript B in several equations (e.g., D1, D22, D38) but is defined nowhere; the main text uses mω². Please clarify whether this subscript is meaningful or a typographical artifact.
  3. [Fig. 5 discussion] The text states that S(t) beyond the plotted range is constant and that the finite-time sum is 'analogous to the MFPT (not the exact MFPT)'. This admission should be prominently connected to the fact that a constant survival tail makes the exact MFPT infinite for the quantity defined in Eq. (11). As written, the figure axes label the finite-time sum as MFPT, which is misleading.

Circularity Check

0 steps flagged · score 0.0 of 10

No circularity: derivation is self-contained; the survival/FPT identification is flawed but that is a correctness issue, not a circular reduction.

full rationale

I find no circular step. The chain GLE→FPE (Appendix D) uses Laplace transforms and Novikov's theorem; the propagator (Appendix E) solves that FPE; the renewal equation (Eq. 8) is the standard last-renewal decomposition for Poissonian resetting and does not pre-suppose the exponential-tail conclusion. No parameter is fitted to the FPT/MFPT; simulations solve the original GLE (Appendix B/C) and are an independent check of the position distribution. The self-citations (refs [18,23,44]) are background/simulation and are not load-bearing. The serious flaw is in Eq. (5): S(t|x0)=∫_{-∞}^{x_a} P(x,t|x0)dx uses the unrestricted propagator, so it is the occupation probability, not the true survival probability with an absorbing boundary; consequently f(t)=-dS/dt is not the FPT density, and the MFPT integral ∫_0^∞ S dt diverges in the Markovian limit. The paper itself concedes in the MFPT section that it integrates only over a finite range and that the result is 'analogous to the MFPT (not the exact MFPT)'—this is a correctness/interpretation defect, not an input-output circularity. The central results are not forced by their own definitions beyond the standard renewal structure.

Assumptions & free parameters 4 free parameters · 5 assumptions · 0 invented entities

The paper introduces no new entities. The free parameters are physical/control parameters (H, r, x_r, zeta, m, omega, kT), not fitted to the escape statistics. The main burden is the domain assumption that the non-Markovian FPE (Eq. 3) is exact for the escape problem, and the validity of the renewal equation for non-Markovian dynamics.

free parameters (4)
  • Hurst index H = 0.5, 0.65, 0.75 (chosen, not fitted)
    Controls the memory kernel exponent. Treated as an input parameter with values in [0.5,1); not fitted to the escape data.
  • reset rate r = varied in figures, not fitted
    Control parameter of the resetting protocol, scanned in Figs. 3-5.
  • reset position x_r = 0, 0.5, 1
    Control parameter of the resetting protocol, scanned in Fig. 5.
  • parameters zeta, m, omega, kT = set to 1 (arbitrary units)
    Physical parameters set to unity, stated as arbitrary in the text; they define the time scale tau_0 but are not fitted to data.
assumptions (5)
  • domain assumption The overdamped GLE with fractional Gaussian noise and power-law kernel is exactly reducible to a time-local Fokker-Planck equation with diffusion coefficient eta(t) (Eq. 3).
    Invoked in Eq. (3) and derived in Appendix D; requires linear (harmonic) force and Gaussian noise, and the specific Novikov-theorem treatment of the memory. This is the main structural premise of the paper.
  • domain assumption Renewal equation (Eq. 8) remains valid for non-Markovian dynamics because reset times are Poissonian and independent of the dynamics.
    Stated in Section II after Eq. (8). This is a standard result for Markovian resetting; its validity for non-Markovian dynamics is assumed, not proved, though it is plausible when resetting fully reinitializes the noise history.
  • domain assumption The fractional Gaussian noise correlation is theta(t)theta(t')=zeta kBT K(t-t'), with K(t)=2H(2H-1)|t|^{2H-2}.
    Used throughout, Eq. (1) and Appendix D. This is the fluctuation-dissipation relation defining the model.
  • domain assumption The FPT distribution is obtained from the survival probability S(t)=integral of P(x,t) over the well (Eqs. 5-7), treating the FPE solution with an absorbing boundary as valid.
    The propagation of the bulk probability P(x,t) uses the FPE without absorbing boundary; the survival probability is then truncated at x_a. This standard approach is assumed valid for the non-Markovian case.
  • standard math Fractional calculus identities (Caputo derivative composition, fundamental theorems of fractional calculus) used in the numerical discretization.
    Invoked in Appendix B, Eq. (B7).

how reviews work

0 comments
Cite this review

Pith. "Pith review of Non-Markovian escape under stochastic resetting." pith.science (2026). https://pith.science/paper/HMX5TD3X

@misc{pith2026250911608,
  author       = {Pith},
  title        = {Pith review of: Non-Markovian escape under stochastic resetting},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/HMX5TD3X}},
  note         = {Machine review of arXiv:2509.11608}
}
read the original abstract

Stochastic resetting is a powerful strategy known to optimize target-search processes at microscopic scales. While its effects on Markovian systems are well understood, its influence on memory-driven systems, such as in viscoelastic baths, has not been adequately investigated. In this work, we study the first-passage properties of escape for a harmonically trapped particle in a non-Markovian environment under stochastic resetting. We employ a complete renewal approach and find that the characteristic non-exponential heavy tail of the first-passage time (FPT) distribution becomes exponential when resetting is introduced. We further find that optimal resetting is achievable at a lower reset rate when the dynamics are weakly correlated; however, for stronger correlations, the process needs to be reset more frequently. Therefore, resetting in memory-driven dynamics can be used as an effective control strategy to initiate faster escape, thereby regulating efficient transport mechanisms in complex chemical and biomolecular environments that follow non-Markovian dynamics.

Figures

Figures reproduced from arXiv: 2509.11608 by the authors.

Figure 1
Figure 1. Probability density P(x, t|x0) corresponding to the escape dynamics governed by GLE, subjected to stochastic resetting. Distributions at different noise strengths and reset rates are shown. (A) and (B) shows the most probable positions for H = 0.5 in the absence and presence of resetting. (C) and (D) shows the same for H = 0.65 and with low and high reset rates. case (H = 0.5), as shown in FIG. 1A, the system reache… view at source ↗
Figure 2
Figure 2. Simulated trajectories and corresponding distributions with and without [PITH_FULL_IMAGE:figures/full_fig_p006_2.png] view at source ↗
Figure 3
Figure 3. Survival probabilities as a function of time at (A) different values of [PITH_FULL_IMAGE:figures/full_fig_p008_3.png] view at source ↗
Figures from the paper (3 more)
Figure 4
Figure 4. Figure 4: Numerically calculated FPT distribution and its comparison with analytical [PITH_FULL_IMAGE:figures/full_fig_p010_4.png]
Figure 5
Figure 5. Figure 5: (A) S(t|x0) at different values of r with xr = 1. (B) MFPT as a function of r with xr = 1. (C) S(t|x0) at different r with xr = 0. (D) MFPT as a function of xr keeping r = 0.2. In all the figures, we fixed H = 0.65 and xa = 3. The horizontal dashed lines show the MFPT …
Figure 6
Figure 6. Figure 6: Comparison of survival probabilities calculated from the renewal equation (solid [PITH_FULL_IMAGE:figures/full_fig_p013_6.png]

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

66 extracted references · 1 linked inside Pith

  1. [1]

    Short-time limit In the small time limit,χ(t) can be approximated asχ(t)≈1−a 1tb wherea 1 = τ b 0 Γ(3−2H) . We used this expression inI(t|x r) which results in I(t|x r)≈ 1 2 " 1 + erf s mω2 2kBT xa −x r +a 1xrtb p 2a1tb −a 2 1t2b # =I 1(t|xr) (A3) This simplifies the expression of the survival probability in the short time limit and is then given by S(t|x...

  2. [2]

    − mω2 Γ(α) nX j=1 xj−1 Z j∆t (j−1)∆t n∆t−t ′ dt′ +G(n∆t) # (B10) Solving the integration, finally, we get, xn =x(0) + 1 A

    Long-time limit In the long time limit,χ(t) can be approximated asχ(t)≈a 2tb, wherea 2 = τ b 0 Γ(2H−1) [17]. Incorporating this function inI(t|x r) leads to I(t|x r)≈ 1 2 " 1 + erf s mω2 2kBT h xa −x ra2t−b + 1 2 xaa2 2t−2b i # =I 2(t|xr) (A5) Therefore, the survival probability in the long-time limit changes to S(t|x0)≈e −rt I(t|x 0) +r Z t 0 dτ e−rτ I2(...

  3. [3]

    All the trajectories were started from the origin att= 0

    We created a two-dimensional numpy array of dimension (ntrajs×N), wherentrajsis the number of trajectories, andNis the total number of time steps for each trajectory. All the trajectories were started from the origin att= 0

  4. [4]

    The simulations were run forN= 50000 steps; therefore, the time interval ∆t=T /N= 0.002

    Trajectories were simulated fort∈[0, t fin] witht fin = 100. The simulations were run forN= 50000 steps; therefore, the time interval ∆t=T /N= 0.002

  5. [5]

    (B9) for Hurst index of 1−H

    We generated Gaussian random variables following Eq. (B9) for Hurst index of 1−H. Different seeds were used for different trajectories. TheFractionalBrownianMotion library from the modulestochasticis used to generate the random variables [57]. We generated arrays of random numbers of lengthNand for the time interval [t init, tfin]

  6. [6]

    Positions of each particle were updated using Eq. (B11)

  7. [7]

    At any time instantt i, ifz < r dt, the particle is brought back to the reset positionx r in the next stept i+1

    To introduce resetting, we called a random numberz∈[0,1] from the uniform distri- bution. At any time instantt i, ifz < r dt, the particle is brought back to the reset positionx r in the next stept i+1. Here,ris the reset rate. A completely new diffusion process starts from the reset position at timet i+1. The memory of the previous process is lost as a r...

  8. [8]

    − x−a(t) 2 2b(t) # (E11) Finally, putting the values ofa(t) andb(t), we get G(x, t|x0,0) = s mω2 B 2πkBT 1−χ 2(t) exp

    When a reset happens ati th step, corresponding to a timet reset, a new sequence of random numbers is generated following step 3 for the next phase of diffusion. The new random numbers have the length ofN−iand for the time interval [t init +t reset, tfin]. These random numbers are completely uncorrelated with the previous ones. These are the steps that ar...

Show all 66 references
  1. [9]

    Escape from a metastable state.Journal of Statistical Physics, 42(1):105–148, 1986

    Peter Hanggi. Escape from a metastable state.Journal of Statistical Physics, 42(1):105–148, 1986

    1986

  2. [10]

    Reaction-rate theory: fifty years after kramers.Reviews of Modern Physics, 62(2):251, 1990

    Peter H¨ anggi, Peter Talkner, and Michal Borkovec. Reaction-rate theory: fifty years after kramers.Reviews of Modern Physics, 62(2):251, 1990

    1990

  3. [11]

    Oxford University Press, 2023

    Peter William Atkins, Julio De Paula, and James Keeler.Atkins’ Physical Chemistry. Oxford University Press, 2023

    2023

  4. [12]

    Polymer translocation through a pore in a membrane.Physical Review Letters, 77(4):783, 1996

    W Sung and PJ Park. Polymer translocation through a pore in a membrane.Physical Review Letters, 77(4):783, 1996

    1996

  5. [13]

    Single-molecule enzymatic dynamics.Science, 282(5395):1877–1882, 1998

    H Peter Lu, Luying Xun, and X Sunney Xie. Single-molecule enzymatic dynamics.Science, 282(5395):1877–1882, 1998

    1998

  6. [14]

    The fluctuating en- zyme: a single molecule approach.Chemical Physics, 247(1):11–22, 1999

    Lars Edman, Zeno F¨ oldes-Papp, Stefan Wennmalm, and Rudolf Rigler. The fluctuating en- zyme: a single molecule approach.Chemical Physics, 247(1):11–22, 1999

    1999

  7. [15]

    Ophir Flomenbom, Kelly Velonia, Davey Loos, Sadahiro Masuo, Mircea Cotlet, Yves Engel- borghs, Johan Hofkens, Alan E Rowan, Roeland JM Nolte, Mark Van der Auweraer, et al. Stretched exponential decay and correlations in the catalytic activity of fluctuating single lipase molec...

    2005

  8. [16]

    Observation of a power- law memory kernel for fluctuations within a single protein molecule.Physical Review Letters, 94(19):198302, 2005

    Wei Min, Guobin Luo, Binny J Cherayil, SC Kou, and X Sunney Xie. Observation of a power- law memory kernel for fluctuations within a single protein molecule.Physical Review Letters, 94(19):198302, 2005

    2005

  9. [17]

    Kramers model with a power-law friction kernel: Dispersed kinetics and dynamic disorder of biochemical reactions.Physical Review E, 73(1):010902, 2006

    Wei Min and X Sunney Xie. Kramers model with a power-law friction kernel: Dispersed kinetics and dynamic disorder of biochemical reactions.Physical Review E, 73(1):010902, 2006

    2006

  10. [18]

    Ever-fluctuating single enzyme molecules: Michaelis-menten equation revisited.Nature Chemical Biology, 2(2):87–94, 2006

    Brian P English, Wei Min, Antoine M Van Oijen, Kang Taek Lee, Guobin Luo, Hongye Sun, Binny J Cherayil, SC Kou, and X Sunney Xie. Ever-fluctuating single enzyme molecules: Michaelis-menten equation revisited.Nature Chemical Biology, 2(2):87–94, 2006. 26

    2006

  11. [19]

    Complex chemical kinetics in single enzyme molecules: Kramers’s model with fractional gaussian noise.The Journal of Chemical Physics, 125(2), 2006

    Srabanti Chaudhury and Binny J Cherayil. Complex chemical kinetics in single enzyme molecules: Kramers’s model with fractional gaussian noise.The Journal of Chemical Physics, 125(2), 2006

    2006

  12. [20]

    Dynamic disorder in single-molecule michaelis- menten kinetics: The reaction-diffusion formalism in the wilemski-fixman approximation.The Journal of Chemical Physics, 127(10), 2007

    Srabanti Chaudhury and Binny J Cherayil. Dynamic disorder in single-molecule michaelis- menten kinetics: The reaction-diffusion formalism in the wilemski-fixman approximation.The Journal of Chemical Physics, 127(10), 2007

    2007

  13. [21]

    Anomalous escape governed by thermal 1/f noise.Physical Review Letters, 99(20):200601, 2007

    Igor Goychuk and Peter H¨ anggi. Anomalous escape governed by thermal 1/f noise.Physical Review Letters, 99(20):200601, 2007

    2007

  14. [22]

    Polymer translocation through a nanopore: A showcase of anomalous diffusion.Physical Review E, 76(1):010801, 2007

    JLA Dubbeldam, A Milchev, VG Rostiashvili, and Thomas A Vilgis. Polymer translocation through a nanopore: A showcase of anomalous diffusion.Physical Review E, 76(1):010801, 2007

    2007

  15. [23]

    Nonexponential kinetics of dna escape fromα-hemolysin nanopores.Biophysical Journal, 95(11):5317–5323, 2008

    Matthew Wiggin, Carolina Tropini, Vincent Tabard-Cossa, Nahid N Jetha, and Andre Marziali. Nonexponential kinetics of dna escape fromα-hemolysin nanopores.Biophysical Journal, 95(11):5317–5323, 2008

    2008

  16. [24]

    Debabrata Panja. Anomalous polymer dynamics is non-markovian: memory effects and the generalized langevin equation formulation.Journal of Statistical Mechanics: Theory and Experiment, 2010(06):P06011, 2010

    2010

  17. [25]

    Anomalous reaction-diffusion as a model of non- exponential dna escape kinetics.The Journal of Chemical Physics, 132(2), 2010

    Debarati Chatterjee and Binny J Cherayil. Anomalous reaction-diffusion as a model of non- exponential dna escape kinetics.The Journal of Chemical Physics, 132(2), 2010

    2010

  18. [26]

    Polymer melt dynamics: Microscopic roots of fractional viscoelasticity.Physical Review E, 81(2):021804, 2010

    Rati Sharma and Binny J Cherayil. Polymer melt dynamics: Microscopic roots of fractional viscoelasticity.Physical Review E, 81(2):021804, 2010

    2010

  19. [27]

    Subdiffusion in hair bundle dynamics: The role of protein conformational fluctuations.The Journal of Chemical Physics, 137(21), 2012

    Rati Sharma and Binny J Cherayil. Subdiffusion in hair bundle dynamics: The role of protein conformational fluctuations.The Journal of Chemical Physics, 137(21), 2012

    2012

  20. [28]

    A near analytic solution of a stochastic immune response model considering variability in virus and t-cell dynamics.The Journal of Chemical Physics, 154(19), 2021

    Abhilasha Batra and Rati Sharma. A near analytic solution of a stochastic immune response model considering variability in virus and t-cell dynamics.The Journal of Chemical Physics, 154(19), 2021

    2021

  21. [29]

    Persistent correlation in cellular noise determines longevity of viral infections.The Journal of Physical Chemistry Letters, 13(31):7252–7260, 2022

    Abhilasha Batra, Shoubhik Chandan Banerjee, and Rati Sharma. Persistent correlation in cellular noise determines longevity of viral infections.The Journal of Physical Chemistry Letters, 13(31):7252–7260, 2022

    2022

  22. [30]

    Springer, 2008

    Venkataraman Balakrishnan.Elements of nonequilibrium statistical mechanics, volume 3. Springer, 2008

    2008

  23. [31]

    Work distribution of a colloid in an elongational flow field and under ornstein-uhlenbeck noise.Physical Review E, 109(1):014111, 2024

    Debasish Saha and Rati Sharma. Work distribution of a colloid in an elongational flow field and under ornstein-uhlenbeck noise.Physical Review E, 109(1):014111, 2024

    2024

  24. [32]

    Long-term memory in- duced correction to arrhenius law.Nature Communications, 15(1):7408, 2024

    A Barbier-Chebbah, O B´ enichou, R Voituriez, and Thomas Gu´ erin. Long-term memory in- duced correction to arrhenius law.Nature Communications, 15(1):7408, 2024. 27

    2024

  25. [33]

    Diffusion with stochastic resetting.Physical Review Letters, 106(16):160601, 2011

    Martin R Evans and Satya N Majumdar. Diffusion with stochastic resetting.Physical Review Letters, 106(16):160601, 2011

    2011

  26. [34]

    Diffusion with optimal resetting.Journal of Physics A: Mathematical and Theoretical, 44(43):435001, 2011

    Martin R Evans and Satya N Majumdar. Diffusion with optimal resetting.Journal of Physics A: Mathematical and Theoretical, 44(43):435001, 2011

    2011

  27. [35]

    Diffusion in a potential landscape with stochastic resetting.Physical Review E, 91(1):012113, 2015

    Arnab Pal. Diffusion in a potential landscape with stochastic resetting.Physical Review E, 91(1):012113, 2015

    2015

  28. [36]

    Stochastic reset- ting in backtrack recovery by rna polymerases.Physical Review E, 93(6):062411, 2016

    ´Edgar Rold´ an, Ana Lisica, Daniel S´ anchez-Taltavull, and Stephan W Grill. Stochastic reset- ting in backtrack recovery by rna polymerases.Physical Review E, 93(6):062411, 2016

    2016

  29. [37]

    First passage under restart.Physical Review Letters, 118(3):030603, 2017

    Arnab Pal and Shlomi Reuveni. First passage under restart.Physical Review Letters, 118(3):030603, 2017

    2017

  30. [38]

    Ex- perimental realization of diffusion with stochastic resetting.The Journal of Physical Chemistry Letters, 11(17):7350–7355, 2020

    Ofir Tal-Friedman, Arnab Pal, Amandeep Sekhon, Shlomi Reuveni, and Yael Roichman. Ex- perimental realization of diffusion with stochastic resetting.The Journal of Physical Chemistry Letters, 11(17):7350–7355, 2020

    2020

  31. [39]

    Diffusion with resetting in a logarithmic potential.The Journal of Chemical Physics, 152(23), 2020

    Somrita Ray and Shlomi Reuveni. Diffusion with resetting in a logarithmic potential.The Journal of Chemical Physics, 152(23), 2020

    2020

  32. [40]

    Space-dependent diffusion with stochastic resetting: A first-passage study.The Journal of Chemical Physics, 153(23), 2020

    Somrita Ray. Space-dependent diffusion with stochastic resetting: A first-passage study.The Journal of Chemical Physics, 153(23), 2020

    2020

  33. [41]

    Stochastic resetting and applica- tions.Journal of Physics A: Mathematical and Theoretical, 53(19):193001, 2020

    Martin R Evans, Satya N Majumdar, and Gr´ egory Schehr. Stochastic resetting and applica- tions.Journal of Physics A: Mathematical and Theoretical, 53(19):193001, 2020

    2020

  34. [42]

    Stochastic resetting antiviral therapies prevent drug resistance development.Europhysics Letters, 132(5):50003, 2020

    Angelo Marco Ramoso, Juan Antonio Magalang, Daniel S´ anchez-Taltavull, Jose Perico Es- guerra, and ´Edgar Rold´ an. Stochastic resetting antiviral therapies prevent drug resistance development.Europhysics Letters, 132(5):50003, 2020

    2020

  35. [43]

    Stochastic resetting: A (very) brief review.Frontiers in Physics, 10:789097, 2022

    Shamik Gupta and Arun M Jayannavar. Stochastic resetting: A (very) brief review.Frontiers in Physics, 10:789097, 2022

    2022

  36. [44]

    Effect of tax dynamics on linearly growing processes under stochastic resetting: A possible economic model.Europhysics Letters, 137(5):52001, 2022

    Ion Santra. Effect of tax dynamics on linearly growing processes under stochastic resetting: A possible economic model.Europhysics Letters, 137(5):52001, 2022

    2022

  37. [45]

    Stochastic resetting for enhanced sam- pling.The Journal of Physical Chemistry Letters, 13(48):11230–11236, 2022

    Ofir Blumer, Shlomi Reuveni, and Barak Hirshberg. Stochastic resetting for enhanced sam- pling.The Journal of Physical Chemistry Letters, 13(48):11230–11236, 2022

    2022

  38. [46]

    Stochastic resetting in the kramers problem: A monte carlo approach.Chaos, Solitons & Fractals, 152:111342, 2021

    Julia Cantis´ an, Jes´ us M Seoane, and Miguel AF Sanju´ an. Stochastic resetting in the kramers problem: A monte carlo approach.Chaos, Solitons & Fractals, 152:111342, 2021

    2021

  39. [47]

    Restarts delay escape over a potential barrier.Chaos, Solitons & Fractals, 194:116112, 2025

    RK Singh. Restarts delay escape over a potential barrier.Chaos, Solitons & Fractals, 194:116112, 2025

    2025

  40. [48]

    Stochastic resetting prevails over sharp restart for broad target distributions.Physical Review Letters, 134(24):247102, 2025

    Martin R Evans and Somrita Ray. Stochastic resetting prevails over sharp restart for broad target distributions.Physical Review Letters, 134(24):247102, 2025. 28

    2025

  41. [49]

    Fractional brownian motions, fractional noises and applications.SIAM Review, 10(4):422–437, 1968

    Benoit B Mandelbrot and John W Van Ness. Fractional brownian motions, fractional noises and applications.SIAM Review, 10(4):422–437, 1968

    1968

  42. [50]

    Modulation of electron transfer kinetics by pro- tein conformational fluctuations during early-stage photosynthesis.The Journal of Chemical Physics, 127(14), 2007

    Srabanti Chaudhury and Binny J Cherayil. Modulation of electron transfer kinetics by pro- tein conformational fluctuations during early-stage photosynthesis.The Journal of Chemical Physics, 127(14), 2007

    2007

  43. [51]

    The dynamics of single enzyme reactions: A reconsideration of kramers’ model for colored noise processes.The Journal of Chemical Physics, 129(7), 2008

    Srabanti Chaudhury, Debarati Chatterjee, and Binny J Cherayil. The dynamics of single enzyme reactions: A reconsideration of kramers’ model for colored noise processes.The Journal of Chemical Physics, 129(7), 2008

    2008

  44. [52]

    Confinement and viscoelastic effects on chain closure dynamics.The Journal of Chemical Physics, 136(23), 2012

    Pinaki Bhattacharyya, Rati Sharma, and Binny J Cherayil. Confinement and viscoelastic effects on chain closure dynamics.The Journal of Chemical Physics, 136(23), 2012

    2012

  45. [53]

    Mittag-leffler functions and their applications.Journal of Applied Mathematics, 2011(1):298628, 2011

    Hans J Haubold, Arak M Mathai, and Ram K Saxena. Mittag-leffler functions and their applications.Journal of Applied Mathematics, 2011(1):298628, 2011

    2011

  46. [54]

    Mathematica, Version 14.0

    Wolfram Research, Inc. Mathematica, Version 14.0. Champaign, IL, 2024

    2024

  47. [55]

    Path-integral formalism for stochastic resetting: Exactly solved examples and shortcuts to confinement.Physical Review E, 96(2):022130, 2017

    ´Edgar Rold´ an and Shamik Gupta. Path-integral formalism for stochastic resetting: Exactly solved examples and shortcuts to confinement.Physical Review E, 96(2):022130, 2017

    2017

  48. [56]

    Springer, 1997

    Rudolf Gorenflo and Francesco Mainardi.Fractional calculus: integral and differential equa- tions of fractional order. Springer, 1997

    1997

  49. [57]

    The fundamental solution of the space-time fractional diffusion equation.arXiv preprint cond-mat/0702419, 2007

    Francesco Mainardi, Yuri Luchko, and Gianni Pagnini. The fundamental solution of the space-time fractional diffusion equation.arXiv preprint cond-mat/0702419, 2007

    2007 arXiv

  50. [58]

    The general fractional derivative and related fractional differential equations.Mathematics, 8(12):2115, 2020

    Yuri Luchko and Masahiro Yamamoto. The general fractional derivative and related fractional differential equations.Mathematics, 8(12):2115, 2020

    2020

  51. [59]

    Wei Min, X Sunney Xie, and Biman Bagchi. Two-dimensional reaction free energy surfaces of catalytic reaction: Effects of protein conformational dynamics on enzyme catalysis.The Journal of Physical Chemistry B, 112(2):454–466, 2008

    2008

  52. [60]

    Zhonghan Hu, Liwen Cheng, and Bruce J Berne. First passage time distribution in stochastic processes with moving and static absorbing boundaries with application to biological rupture experiments.The Journal of Chemical Physics, 133(3), 2010

    2010

  53. [61]

    A simple method to calculate first- passage time densities with arbitrary initial conditions.New Journal of Physics, 18(6):063019, 2016

    Markus Nyberg, Tobias Ambj¨ ornsson, and Ludvig Lizana. A simple method to calculate first- passage time densities with arbitrary initial conditions.New Journal of Physics, 18(6):063019, 2016

    2016

  54. [62]

    Results for nonlinear diffusion equations with stochastic resetting.Entropy, 25(12):1647, 2023

    Ervin K Lenzi, Rafael S Zola, Michely P Rosseto, Renio S Mendes, Haroldo V Ribeiro, Luciano R da Silva, and Luiz R Evangelista. Results for nonlinear diffusion equations with stochastic resetting.Entropy, 25(12):1647, 2023

    2023

  55. [63]

    Fractional stochastic differential equations satisfying fluctuation-dissipation theorem.Journal of Statistical Physics, 169(2):316–339, 2017

    Lei Li, Jian-Guo Liu, and Jianfeng Lu. Fractional stochastic differential equations satisfying fluctuation-dissipation theorem.Journal of Statistical Physics, 169(2):316–339, 2017. 29

    2017

  56. [64]

    Di Fang and Lei Li. Numerical approximation and fast evaluation of the overdamped general- ized langevin equation with fractional noise.ESAIM: Mathematical Modelling and Numerical Analysis, 54(2):431–463, 2020

    2020

  57. [65]

    Stochastic: A python package for generating realizations of stochastic processes

    Christopher Flynn. Stochastic: A python package for generating realizations of stochastic processes. Available athttps://stochastic.readthedocs.io/, 2018

    2018

  58. [66]

    Functionals and the random-force method in turbulence theory.Sov

    Evgenii A Novikov. Functionals and the random-force method in turbulence theory.Sov. Phys. JETP, 20(5):1290–1294, 1965

    1965

Pith tools

Reviewed August 4, 2026 · model on record in the stance chip above.