Pith. sign in

REVIEW 2 cited by

SoK: Reducing the Vulnerability of Fine-tuned Language Models to Membership Inference Attacks

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2403.08481 v1 pith:3E7LNVXH submitted 2024-03-13 cs.LG cs.CR

classification cs.LGcs.CR
keywords languagemodelsprivacyattacksinferencemembershipvulnerabilityapplications
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

Natural language processing models have experienced a significant upsurge in recent years, with numerous applications being built upon them. Many of these applications require fine-tuning generic base models on customized, proprietary datasets. This fine-tuning data is especially likely to contain personal or sensitive information about individuals, resulting in increased privacy risk. Membership inference attacks are the most commonly employed attack to assess the privacy leakage of a machine learning model. However, limited research is available on the factors that affect the vulnerability of language models to this kind of attack, or on the applicability of different defense strategies in the language domain. We provide the first systematic review of the vulnerability of fine-tuned large language models to membership inference attacks, the various factors that come into play, and the effectiveness of different defense strategies. We find that some training methods provide significantly reduced privacy risk, with the combination of differential privacy and low-rank adaptors achieving the best privacy protection against these attacks.

Discussion (0). Sign in to comment.

Forward citations

Cited by 2 Pith papers

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. LLM in the Middle: A Systematic Review of Threats and Mitigations to Real-World LLM-based Systems

    cs.CR 2025-09 conditional novelty 6.0 of 10

    A systematic review that categorizes LLM threats, severity scores, and mitigations across development and operation life cycles and multiple deployment scenarios.

  2. DCMI: A Differential Calibration Membership Inference Attack Against Retrieval-Augmented Generation

    cs.CR 2025-09 conditional novelty 6.0 of 10

    DCMI infers RAG database membership by subtracting the system's yes-probability on a perturbed query from the original query, cancelling the interference of non-member retrieved documents.

Pith tools