Pith. sign in

REVIEW 1 cited by

Gravitational traces of bumblebee gravity in metric-affine formalism

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2305.18871 v2 pith:5FCZM6AG submitted 2023-05-30 gr-qc hep-th

classification gr-qchep-th
keywords bumblebeecalculationsformalismgravitationalgravityhawkinglargermetric-affine
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
abstract

This work explores various manifestations of bumblebee gravity within the metric-affine formalism. We investigate the impact of the Lorentz violation parameter, denoted as $X$, on the modification of the Hawking temperature. Our calculations reveal that as $X$ increases, the values of the Hawking temperature attenuate. To examine the behavior of massless scalar perturbations, specifically the quasinormal modes, we employ the WKB method. The transmission and reflection coefficients are determined through our calculations. The outcomes indicate that a stronger Lorentz-violating parameter results in slower damping oscillations of gravitational waves. To comprehend the influence of the quasinormal spectrum on time-dependent scattering phenomena, we present a detailed analysis of scalar perturbations in the time-domain solution. Additionally, we conduct an investigation on shadows, revealing that larger values of $X$ correspond to larger shadow radii. Furthermore, we constrain the magnitude of the shadow radii using the EHT horizon-scale image of $Sgr A^*$. Finally, we calculate both the time delay and the deflection angle.

Discussion (0). Continue with ORCID to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score. Full citation record

  1. Quasinormal Modes and Dynamical Evolution of Scalar Fields in the Einstein-Bumblebee Theory with a Cosmological Constant

    gr-qc 2025-02 conditional novelty 4.0 of 10

    For scalar perturbations of Einstein-Bumblebee black holes in de Sitter spacetime, increasing the Lorentz-violation parameter or the cosmological constant generally lowers the quasinormal mode frequency and damping rate.

Pith tools