Pith. sign in

REVIEW 1 cited by

Adaptive Multimodal Protein Plug-and-Play with Diffusion-Based Priors

Not yet reviewed by Pith; the record is open.

This paper has not been read by Pith yet. Machine review is queued; the pith claim, tier, and objections will appear here once it completes.

SPECIMEN: schema-true, not a live event

T0 review · schema-true

One-sentence machine reading of the paper's core claim.

pith:XXXXXXXX · record.json · timestamp

arxiv 2507.21260 v1 pith:5XI5SAUO submitted 2025-07-28 cs.LG cs.AIq-bio.QM

classification cs.LGcs.AIq-bio.QM
keywords diffusionexperimentalmodelsproteinadam-pnpadaptivedataframework
verification ladder T0 review T1 audit T2 compute T3 formal
0 comments
read the original abstract

In an inverse problem, the goal is to recover an unknown parameter (e.g., an image) that has typically undergone some lossy or noisy transformation during measurement. Recently, deep generative models, particularly diffusion models, have emerged as powerful priors for protein structure generation. However, integrating noisy experimental data from multiple sources to guide these models remains a significant challenge. Existing methods often require precise knowledge of experimental noise levels and manually tuned weights for each data modality. In this work, we introduce Adam-PnP, a Plug-and-Play framework that guides a pre-trained protein diffusion model using gradients from multiple, heterogeneous experimental sources. Our framework features an adaptive noise estimation scheme and a dynamic modality weighting mechanism integrated into the diffusion process, which reduce the need for manual hyperparameter tuning. Experiments on complex reconstruction tasks demonstrate significantly improved accuracy using Adam-PnP.

Discussion (0). Sign in to comment.

Forward citations

Cited by 1 Pith paper

Reviewed papers in the Pith corpus that reference this work. Sorted by Pith novelty score.

  1. Valid Property-Enhanced Contrastive Learning for Targeted Optimization & Resampling for Novel Drug Design

    cs.LG 2025-08 conditional novelty 5.0 of 10

    VECTOR+ combines contrastive learning and Gaussian mixture sampling to generate novel, synthetically plausible inhibitors from low-data datasets, with improved docking scores over known compounds.

Pith tools