Pith. sign in

REVIEW 4 major objections 6 minor 33 references

Theoretical Models for Tension-Dependent DNA Looping Time

T0 review · 4 major / 6 minor · reviewed 2026-08-10 · deepseek-v4-flash

Challenge this review Re-run · record.json Download PDF Read on arXiv ↗ Review JSON

Pith's one-line read For long semiflexible chains, the tension-dependent DNA looping time is the inverse of the equilibrium looping probability, giving exponential-in-$f^2$ growth at low force and agreement with simulation over the full force range.

desk verdict Useful, honest Letter; inverse-probability scaling for looping time under tension is well supported for long chains, but the scaling is assumed rather than derived. read the letter →

arxiv 2501.09584 v1 pith:HEIWVIPH submitted 2025-01-16 cond-mat.stat-mech physics.bio-ph

Wout Laeremans , Wouter G Ellenbroek This is my paper · ORCID
classification cond-mat.stat-mechphysics.bio-ph MSC 82D6082C31
keywords DNAloopingsemiflexiblepolymertimeequilibriumprobabilityworm-likechainforce-dependentkineticsmeanfirstpassagetwo-statemodel
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper sets out to settle which theoretical description correctly predicts how tension slows DNA looping. It argues that for long semiflexible chains, meaning about four persistence lengths or more, the looping time $\tau(f)$ is simply the inverse of the equilibrium looping probability, $\tau(f) \sim 1/P_{\rm loop}(f)$, over the whole force range. That relation yields exponential-in-$f^2$ growth at low force, matching the older two-state model's scaling but for a different reason, and it avoids the single-reaction-coordinate free energy on which the rival barrier-escape theory depends. The paper supports the claim with bead-spring simulations and uses it to explain why the barrier-escape theory only seemed to fit existing optical-tweezer data in a narrow force window. If correct, it gives a practical route to predict looping kinetics from equilibrium loop-closure probabilities and makes low-force predictions that future experiments can test.

What carries the argument

The load-bearing object is the inverse scaling relation $\tau(f) \sim 1/P_{\rm loop}(f)$, where $P_{\rm loop}(f)$ is the equilibrium probability that the chain's end-to-end distance is within a capture radius. It is obtained by writing the equilibrium distribution as $e^{-\beta F(0,f)}/Z(f) \sim 1/Z(f)$, using the Markov-chain recurrence-time relation, and then translating $Z(f)$ into $F(\langle x(f)\rangle)$ with the thermodynamic identity $G(f)=F(\langle x(f)\rangle)$. The force-extension curve of the worm-like chain, evaluated analytically, closes the calculation. This machinery matters because it replaces the barrier-escape reaction coordinate with a property that can be computed from equilibrium loop-closure probability alone.

What would settle it

A direct test would be an optical-tweezer measurement of $\tau(f)$ on a DNA construct with $L \gtrsim 4l_p$ at forces below roughly 80 fN: the model predicts that $\log \tau$ grows quadratically with force, while the barrier-escape theory predicts almost linear growth in force, so the curvature of the measured curve decides.

Watch

Extended reading notes

Core claim

The paper's central claim is that, for a semiflexible chain under tension, the mean looping time is inversely proportional to the equilibrium looping probability for long chains, and that this proportionality is the correct organizing principle for the force dependence. Concretely, because a loop corresponds to an end-to-end distance near zero, $P_{\rm loop}(f) \sim 1/Z(f)$, and then $\tau(f) \sim e^{-\beta F(\langle x(f)\rangle)}$. This reproduces the quadratic-exponential growth of the two-state model in the low-force limit but interprets it as an equilibrium-probability statement rather than a two-state energy gap. The paper validates the claim with simulations for $L/l_p$ from 2.2 to 8, finding that the inverse-probability model tracks the whole force range for $L/l_p \gtrsim 4.6$, while the two prior theories fail except in narrow regimes.

Load-bearing premise

The argument depends on the assumption, imported from earlier work rather than proved here, that the average time for an unlooped chain to first form a loop equals the inverse of the equilibrium looping probability; if that equality fails, the model's predictions collapse.

Editorial extensions

If this is right

  • For chains with $L \gtrsim 4l_p$, looping kinetics can be predicted directly from equilibrium looping probabilities, avoiding the fragile reaction-coordinate free energy of the barrier-escape route.
  • The low-force scaling debate is settled in favor of exponential-in-$f^2$ growth, matching the two-state model's functional form but for a different reason.
  • The apparent experimental agreement with the barrier-escape model in the 60--180 fN range is not strong evidence for that model, since the simulations show deviations just outside that range.
  • The model gives force-dependent predictions that are within reach of optical-tweezer experiments at sub-piconewton forces.
  • Because the derivation is not tied to a specific polymer model, the same inverse-probability relation should hold for other semiflexible chains once their equilibrium looping probability is known.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • Editorial extension: any method that computes equilibrium loop-closure probabilities, such as J-factor calculations for sequence-dependent or supercoiled DNA, becomes a kinetic prediction for long chains; this link is implicit in the paper but not developed there.
  • Editorial extension: the paper's explanation of the short-chain breakdown, that the capture radius is not small relative to chain length, suggests that a finite-capture-radius correction to $1/P_{\rm loop}$ could extend the theory to shorter DNA; the authors do not propose one.
  • Editorial extension: because the reduction to the two-state model is described as a mathematical coincidence rather than a physical mechanism, fitting experimental looping-time data to a two-state Arrhenius form could be misleading; the paper hints at this risk when discussing protein size, and the warning could be sharpened by fitting simulated data to both functional forms.
Share X Bluesky LinkedIn Reddit HN

Signed reviews

No signed human review yet.

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, and a circularity audit.

Referee Report

4 major / 6 minor

Summary. The paper reviews two existing theories for tension-dependent DNA looping — the two-state model of Blumberg et al. and the barrier-escape approach of Shin et al. — and compares them with optical-tweezer data and with new Langevin simulations of semiflexible chains. The authors propose a third model in which the looping time is inversely proportional to the equilibrium looping probability, leading for a wormlike chain to Eq. (8), τ(f) ∼ exp[-βF(⟨x(f)⟩)], and hence to exponential-in-f^2 growth at low force. They find that this model agrees with simulations for long chains (L ≳ 4l_p) over the whole force range tested, while the prior theories fail outside a narrower parameter regime.

Significance. The paper has several strengths: it provides a compact comparison of existing theories, identifies a simple and analytically evaluable prediction, tests the prediction over a wider force range than the original experiment, and includes a finite-size check for the shortest chain. If Eq. (8) is established, the low-force f^2 prediction would resolve a concrete controversy and be directly useful for designing DNA-looping experiments. However, the central inverse-scaling assumption is imported from previous work rather than derived, and the simulation validation is shape-based rather than absolute; these points need to be addressed before the main claim can be considered established.

major comments (4)
  1. [Section III, first paragraph and Eq. (8)] The central scaling τ(f) ∼ 1/P_loop(f) is introduced by invoking the Markov-chain recurrence theorem, but the theorem gives the mean recurrence time to a state starting from that state, whereas the simulations measure the mean first-passage time from an equilibrated unlooped configuration to the looped set r ≤ r_c. In a two-state description these two quantities are 1/k_on and (k_on + k_off)/k_on respectively; they coincide only in the absorbing-loop limit k_off ≪ k_on, which is not established for the capture-radius definition used here. The equivalence should either be derived for semiflexible chains or explicitly identified as an additional dynamical assumption, with evidence that any missing prefactor is force-independent over the tested range.
  2. [Fig. 3 and Supplementary Fig. 4] The simulation comparison does not actually test the proportionality τ ∼ 1/P_loop, because each theory curve is vertically shifted to coincide with one simulation point ('we made them coincide with the simulation for the most upper data point at every length'; the supplementary figure states that the lines are 'shifted arbitrarily'). This compares only the shape of τ(f)/τ(0), not the absolute relation τ(f)P_loop(f). A plot of the unscaled product τ(f)P_loop(f) versus f for the long-chain data, or an absolute comparison with a single independently justified normalization across all lengths and forces, is needed to support Eq. (8).
  3. [Section III, after Eq. (7)] The statement G(f) = F(⟨x(f)⟩) is used to pass from the partition function to the force-extension free energy, but this identity is not generally valid for a wormlike chain; it would follow from a saddle-point evaluation of Z(f), whose accuracy is not examined. Without a check against the simulated ⟨x(f)⟩ or a numerical evaluation of Z(f), Eq. (8) is not a parameter-free consequence of the inverse-scaling assumption, and the claimed reduction to the Blumberg result for x_c → 0 remains a limiting statement rather than a derivation.
  4. [Section III, Eqs. (6)–(7)] The approximation P_loop(f) ∼ 1/Z(f) neglects exp(β f x) in the looped region, which requires β f r_c ≪ 1. With the simulation parameters β = 1 and r_c = 1, this condition is violated for f ≳ 0.3, i.e., for a substantial part of the force range in which the model is claimed to work. The authors should quantify the error introduced by this approximation or restrict the low-force claim accordingly.
minor comments (6)
  1. [Section III, after Eq. (8)] 'Inversionally proportional' should read 'inversely proportional'; the same typo appears in the Conclusion.
  2. [Introduction, paragraph 2] The citation 'the two-state model of Blumberg et al. [10]' appears to be a numbering error: Ref. [9] is the two-state paper, while Ref. [10] is Shin et al.
  3. [Fig. 3 caption] 'Most upper data point' should be 'uppermost data point', and the vertical rescaling constants C for each chain length should be stated in the main text, not only in the caption, because they are part of the comparison procedure.
  4. [Section IV, Simulation] 'A loop is defined as the mean first passage time for r to become smaller than or equal to the capture radius' should be 'The looping time is defined as the mean first passage time for r to become smaller than or equal to the capture radius'.
  5. [Supplementary Material, Ref. [14]] 'Jhon Willey & Sons, Inc.' should be 'John Wiley & Sons, Inc.'.
  6. [Section V, Results] The phrase 'quadratic-exponential increase' would be clearer if it were stated once as 'an increase exponential in f^2', since this is the specific functional form being claimed.

Circularity Check

0 steps flagged · score 2.0 of 10

No load-bearing circularity: the central inverse-scaling assumption is taken from prior work (including a self-citation) but is independently validated by the paper's own simulations; the reduction to the two-state model is a mathematical limit, not a fitted input.

full rationale

The paper's core claim is that τ(f) ~ 1/P_loop(f), giving Eq. 8, τ(f) ~ exp(−βF(⟨x(f)⟩)). This is presented as an assumption imported from earlier work (Refs. 13 and 15) plus the Kac recurrence theorem, and it is not derived from first principles. However, no circularity is created because the assumption is then tested independently by Langevin simulations over a broad force and length range (Fig. 3), and by zero-force looping-time simulations (Fig. 4). The theoretical curves are deliberately shifted to one simulation point because only the force-scaling is predicted; the f-dependence is derived, not fitted, and the quoted comparison is of τ(f)/τ(0) shape. The reduction to the Blumberg two-state model (Eq. 3) for xc→0 is a mathematical consequence of combining the inverse-scaling ansatz with P_loop ~ 1/Z(f), not an input that forces the result. The self-citation to Ref. 13 is real, but it is not the sole support: the paper also cites Ref. 15, invokes the general Markov-chain recurrence relation, and supplies its own numerical validation. The main weakness is the unproven dynamical equivalence between a first-passage time from the unlooped state and 1/P_loop, but that is a correctness/assumption risk, not a circular reduction. Hence no specific circular step can be exhibited; the analysis is self-contained against the simulations it reports.

Assumptions & free parameters 2 free parameters · 4 assumptions · 0 invented entities

The model introduces no new physical entities. It rests on a statistical-mechanics relation (inverse scaling), a thermodynamic approximation, and a small-capture-radius approximation, plus two fitted parameters used in comparisons (lP and a vertical rescaling constant).

free parameters (2)
  • lP (persistence length in Fig. 2) = 33.9 nm
    Adopted from a fit of the force-extension relation in Ref. 19; lower than the commonly used 50 nm. This choice affects the comparison between theory and experimental data in Fig. 2.
  • C (vertical rescaling constant in Fig. 3) = varies per length and per theory
    Each theoretical curve is multiplied by a constant C to match the simulation at the highest force for each length, so only the force-dependence shape is tested.
assumptions (4)
  • standard math Mean recurrence time of a state in an ergodic Markov chain is inversely proportional to its stationary probability (Kac's lemma).
    Invoked in Section III, paragraph 1, citing Ref. 14; provides the basis for the inverse scaling of looping time with looping probability.
  • domain assumption For a semiflexible chain under tension, the looping time is inversely proportional to the equilibrium looping probability.
    Taken from Refs. 13 and 15 and confirmed by simulation in the paper. Not derived from first principles in this work.
  • domain assumption The free energy at the average extension equals the Gibbs free energy, G(f) = F(<x(f)>).
    Used in Section III to obtain Eq. 8. This is exact only for sharply peaked distributions (e.g., harmonic spring); for a general wormlike chain it is an approximation.
  • ad hoc to paper In the looped state the extension along the force is negligible, so exp(beta f x) is approximately 1.
    Used in Section III between Eqs. 6 and 7. Requires beta f r_c << 1; for the simulations with r_c = 1 and f up to about 1, this is not strictly satisfied.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Theoretical Models for Tension-Dependent DNA Looping Time." pith.science (2026). https://pith.science/paper/HEIWVIPH

@misc{pith2026250109584,
  author       = {Pith},
  title        = {Pith review of: Theoretical Models for Tension-Dependent DNA Looping Time},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/HEIWVIPH}},
  note         = {Machine review of arXiv:2501.09584}
}
read the original abstract

The influence of tension on DNA looping has been studied both experimentally and theoretically in the past. However, different theoretical models have yielded different predictions, leaving uncertainty about their validity. We briefly review the predictions of those models and propose a novel model that demonstrates exceptional agreement with simulations for long semiflexible chains. Additionally, we elucidate the relationship between our result and that of the previously proposed two-state model, highlighting the distinct interpretative approach that underpins our framework. Our findings offer predictive insights that pave the way for future experimental validation.

Figures

Figures reproduced from arXiv: 2501.09584 by the authors.

Figure 1
Figure 1. Protein-mediated DNA looping occurs when two distal [PITH_FULL_IMAGE:figures/full_fig_p001_1.png] view at source ↗
Figure 2
Figure 2. Experimental data of Chen et al. [8] measured using an op [PITH_FULL_IMAGE:figures/full_fig_p002_2.png] view at source ↗
Figure 3
Figure 3. Three different theories (from left to right): Blumberg et al. [9] (two-state model), Shin et al. [10] (barrier escape approach) and [PITH_FULL_IMAGE:figures/full_fig_p003_3.png] view at source ↗
Figures from the paper (2 more)
Figure 4
Figure 4. Figure 4: Looping time at zero force as measured in a simulation for [PITH_FULL_IMAGE:figures/full_fig_p006_4.png]
Figure 5
Figure 5. Figure 5: Normalized looping time τ(f)/τ(f = 0) for L = 11 using two different coarse-grainings. The first (black triangle) has N = 11, b = 1 and κ = 5, while the second (red triangle) has N = 22, b = 0.5 and κ = 10. No noticeable difference can be seen, hence no finite size eff…

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

33 extracted references · 31 canonical work pages

  1. [1]

    Schleif, Dna looping, Annual review of biochemistry61, 199 (1992)

    R. Schleif, Dna looping, Annual review of biochemistry61, 199 (1992)

    1992

  2. [2]

    J. F. Allemand, S. Cocco, N. Douarche, and G. Lia, Loops in dna: an overview of experimental and theoretical approaches, The European Physical Journal E 19, 293 (2006)

    work page 2006

  3. [3]

    Milstein and J.-C

    J. Milstein and J.-C. Meiners, On the role of dna biomechan- ics in the regulation of gene expression, Journal of The Royal Society Interface 8, 1673 (2011)

    work page 2011

  4. [4]

    Matthews, Dna looping, Microbiological reviews 56, 123 (1992)

    K. Matthews, Dna looping, Microbiological reviews 56, 123 (1992)

    work page 1992

  5. [5]

    Y .-F. Chen, J. Milstein, and J.-C. Meiners, Femtonewton en- tropic forces can control the formation of protein-mediated dna loops, Physical review letters 104, 048301 (2010)

    work page 2010

  6. [6]

    Rivas, F

    G. Rivas, F. Ferrone, and J. Herzfeld, Life in a crowded world: Workshop on the biological implications of macromolecular crowding, EMBO reports 5, 23 (2004)

    work page 2004

  7. [7]

    Gallet, D

    F. Gallet, D. Arcizet, P. Bohec, and A. Richert, Power spectrum of out-of-equilibrium forces in living cells: amplitude and fre- quency dependence, Soft matter 5, 2947 (2009)

    work page 2009

  8. [8]

    Y .-F. Chen, J. Milstein, and J.-C. Meiners, Protein-mediated dna loop formation and breakdown in a fluctuating environment, Physical Review Letters 104, 258103 (2010)

    work page 2010

Show all 33 references
  1. [9]

    Blumberg, A

    S. Blumberg, A. V . Tkachenko, and J.-C. Meiners, Disruption of protein-mediated dna looping by tension in the substrate dna, Biophysical journal 88, 1692 (2005)

    2005

  2. [10]

    Shin and W

    J. Shin and W. Sung, Effects of static and temporally fluctuat- ing tensions on semiflexible polymer looping, The Journal of Chemical Physics 136 (2012)

    2012

  3. [11]

    Grosberg, Theoretical and mathematical models in polymer research (Academic Press, Boston, 1998)

    A. Grosberg, Theoretical and mathematical models in polymer research (Academic Press, Boston, 1998)

    1998

  4. [12]

    J. F. Marko and E. D. Siggia, Stretching dna, Macromolecules 28, 8759 (1995)

    1995

  5. [13]

    Laeremans, A

    W. Laeremans, A. F. den Ouden, J. Hooyberghs, and W. G. El- lenbroek, Polymer dynamics under tension: mean first passage time for looping, arXiv preprint arXiv:2410.01347 (2024)

    2024 arXiv

  6. [14]

    Wolfowitz, An introduction to probability theory and its ap- plications

    J. Wolfowitz, An introduction to probability theory and its ap- plications. Vol. I (Jhon Willey & Sons, Inc., 1951)

    1951

  7. [15]

    S. Jun, J. Bechhoefer, and B.-Y . Ha, Diffusion-limited loop for- mation of semiflexible polymers: Kramers theory and the inter- twined time scales of chain relaxation and closing, Europhysics Letters 64, 420 (2003)

    2003

  8. [16]

    D. H. Boal, Mechanics of the Cell(Cambridge University Press, 2012)

    2012

  9. [17]

    N. M. Toan, G. Morrison, C. Hyeon, and D. Thirumalai, Kinet- ics of loop formation in polymer chains, The Journal of Physical Chemistry B 112, 6094 (2008)

    2008

  10. [18]

    Marantan and L

    A. Marantan and L. Mahadevan, Mechanics and statistics of the worm-like chain, American Journal of Physics 86, 86 (2018)

    2018

  11. [19]

    Y .-F. Chen, G. A. Blab, and J.-C. Meiners, Stretching submi- cron biomolecules with constant-force axial optical tweezers, Biophysical journal 96, 4701 (2009)

    2009

  12. [20]

    C. G. Baumann, S. B. Smith, V . A. Bloomfield, and C. Busta- mante, Ionic effects on the elasticity of single DNA molecules, Proc. Natl. Acad. Sci. USA 94, 6185 (1997)

    1997

  13. [21]

    Y . Seol, J. Li, P. C. Nelson, T. T. Perkins, and M. Betterton, Elasticity of short dna molecules: theory and experiment for contour lengths of 0.6–7 µm, Biophysical journal 93, 4360 (2007)

    2007

  14. [22]

    Skoruppa, A

    E. Skoruppa, A. V oorspoels, J. Vreede, and E. Carlon, Length- scale-dependent elasticity in dna from coarse-grained and all- atom models, Physical Review E 103, 042408 (2021)

    2021

  15. [23]

    Segers, A

    M. Segers, A. V oorspoels, T. Sakaue, and E. Carlon, Mechan- ical properties of nucleic acids and the non-local twistable wormlike chain model, The Journal of Chemical Physics 156 (2022)

    2022

  16. [24]

    Y . A. Gutiérrez Fosado, F. Landuzzi, and T. Sakaue, Coarse graining dna: Symmetry, nonlocal elasticity, and persistence length, Physical Review Letters 130, 058402 (2023)

    2023

  17. [25]

    Laeremans, M

    W. Laeremans, M. Segers, A. V oorspoels, E. Carlon, and J. Hooyberghs, Insights into elastic properties of coarse-grained DNA models: q-stiffness of cgDNA vs cgDNA+, The Journal of Chemical Physics 160, 144105 (2024)

    2024

  18. [26]

    Skoruppa and H

    E. Skoruppa and H. Schiessel, Systematic coarse-graining of sequence-dependent structure and elasticity of double-stranded dna, Phys. Rev. Res. 7, 013044 (2025)

    2025

  19. [27]

    Sinha and S

    S. Sinha and S. Chattopadhyay, Ring closure in actin polymers, Physics Letters A 381, 1029 (2017)

    2017

  20. [28]

    Shimada and H

    J. Shimada and H. Yamakawa, Ring-closure probabilities for twisted wormlike chains. application to dna, Macromolecules 17, 689 (1984)

    1984

  21. [29]

    Guérin, Analytical expressions for the closure probability of a stiff wormlike chain for finite capture radius, Physical Review E 96, 022501 (2017)

    T. Guérin, Analytical expressions for the closure probability of a stiff wormlike chain for finite capture radius, Physical Review E 96, 022501 (2017)

    2017

  22. [30]

    Petrosyan, Improved approximations for some polymer ex- tension models, Rheologica Acta 56, 21 (2017)

    R. Petrosyan, Improved approximations for some polymer ex- tension models, Rheologica Acta 56, 21 (2017)

    2017

  23. [31]

    A. P. Thompson, H. M. Aktulga, R. Berger, D. S. Bolintineanu, W. M. Brown, P. S. Crozier, P. J. in ’t Veld, A. Kohlmeyer, S. G. Moore, T. D. Nguyen, R. Shan, M. J. Stevens, J. Tranchida, C. Trott, and S. J. Plimpton, LAMMPS - a flexible simula- tion tool for particle-based mat...

    2022

  24. [32]

    Hijazi, D

    M. Hijazi, D. M. Wilkins, and M. Ceriotti, Fast-forward langevin dynamics with momentum flips, The Journal of chem- ical physics 148 (2018)

    2018

  25. [33]

    J. R. Gissinger, B. D. Jensen, and K. E. Wise, Reacter: A heuris- tic method for reactive molecular dynamics, Macromolecules 53, 9953 (2020). 6 SUPPLEMENTARY MA TERIAL Parameters for the Optical Tweezer experiment In Ref. 8, the looping time was measured experimentally using o...

    2020

Pith tools

Reviewed August 10, 2026 · model on record in the stance chip above.