Pith. sign in

REVIEW 2 major objections 2 minor 57 references

Spin-wave phase modulation using magnetic domain walls in dipolarly coupled structures for non-volatile magnonic computation

T0 review · 2 major / 2 minor · reviewed 2026-06-28 · grok-4.3

Pith's one-line read Displacing a domain wall in a half-ring continuously tunes spin-wave phase by nearly 360 degrees via changed dipolar coupling while amplitude stays fixed.

desk verdict The simulations show a workable half-ring plus waveguide geometry for non-volatile spin-wave phase control via domain-wall position, but the result is generated entirely by micromagnetic modeling with no visible validation. read the letter →

arxiv 2606.03336 v1 pith:I4NOMWOT submitted 2026-06-02 cond-mat.mes-hall cond-mat.soft

classification cond-mat.mes-hallcond-mat.soft
keywords spin-wavephaseshiftermagneticdomainwalldipolarcouplingmagnoniccomputationmicromagneticsimulationbismuth-dopedYIGperpendicularanisotropynon-volatilecontrol
verification ladder T0 review T1 audit T2 compute T3 formal

The pith

A machine-rendered reading of the paper's core claim, the machinery that carries it, and where it could break.

The reading

The paper establishes that positioning a magnetic domain wall inside a half-ring structure can control the phase of spin waves propagating in an adjacent straight waveguide. The control arises because moving the wall alters the strength of the magnetostatic interaction between the two elements, which in turn shifts the dispersion relation experienced by the waves. A sympathetic reader would care because this supplies a compact, bias-free, and non-volatile way to implement the phase shifters required for spin-wave logic circuits. The tuning range approaches a full cycle and the wave amplitude remains unchanged throughout the adjustment. All results are obtained from micromagnetic simulations of bismuth-doped yttrium iron garnet films that possess strong perpendicular anisotropy.

What carries the argument

Domain-wall position inside the half-ring, which serves as the control variable that modifies the dipolar field acting on the straight waveguide and thereby its spin-wave dispersion.

What would settle it

Fabricate the half-ring and straight waveguide from bismuth-doped YIG, displace the domain wall while measuring transmitted spin-wave phase under zero bias, and check whether the phase changes continuously over nearly 360 degrees at constant amplitude.

Watch

Extended reading notes

Core claim

Displacing a domain wall in the half-ring modulates the dispersion relation in the adjacent straight waveguide due to the changed magnetostatic interaction, providing a compact and dynamically reconfigurable phase-shifting mechanism with continuous phase tuning over a range approaching 360 degrees while keeping the spin-wave amplitude constant.

Load-bearing premise

The micromagnetic model together with the chosen bismuth-doped YIG parameters and coupling distances accurately reproduces the behavior of a real fabricated device under zero external field.

Editorial extensions

If this is right

  • Phase shifters for magnonic logic become possible without continuous external fields or power to hold the state.
  • Domain-wall displacement supplies non-volatile reconfiguration of spin-wave propagation characteristics.
  • Constant amplitude during phase modulation preserves signal strength through cascaded magnonic elements.
  • The hybrid half-ring-plus-waveguide geometry offers a compact building block compatible with energy-efficient magnonic architectures.

Reading between the lines

Editorial extensions of the paper, not claims the author makes directly.

  • The same dipolar-coupling principle could be tested in other geometries to create tunable delay lines or interferometers.
  • Pairing the structure with electrical domain-wall drivers would allow fully electrical write and read of the phase state.
  • Variations in real coupling distance or film quality would set the practical limits on achievable phase precision.
Share X Bluesky LinkedIn Reddit HN

Editorial analysis

A structured set of objections, weighed in public.

Desk editor's note, referee report, simulated authors' rebuttal, and a circularity audit.

Referee Report

2 major / 2 minor

Summary. The manuscript proposes a bias-free spin-wave phase shifter consisting of a straight waveguide magnetostatically coupled to a half-ring structure, both fabricated from bismuth-doped YIG with strong perpendicular magnetic anisotropy. Micromagnetic simulations show that displacing a domain wall within the half-ring alters the dipolar coupling, thereby modulating the dispersion relation in the waveguide to produce continuous phase shifts approaching 360° while maintaining constant spin-wave amplitude. The mechanism is presented as a compact, dynamically reconfigurable, and non-volatile element suitable for magnonic logic.

Significance. If the reported phase modulation holds under realistic conditions, the work would provide a useful addition to magnonic device concepts by demonstrating how domain-wall positioning can serve as a non-volatile control knob for phase without external bias fields or amplitude degradation. The simulations illustrate a clear physical mechanism based on changed magnetostatic interaction, which is a standard and appropriate approach for such proposals. The absence of fitted parameters or ad-hoc tuning in the central result is a positive feature.

major comments (2)
  1. [Methods] Methods section: the saturation magnetization, uniaxial anisotropy constant, exchange stiffness, and Gilbert damping values used for the Bi:YIG films are not stated. Because the dispersion modulation and resulting phase range are obtained by solving the LLG equation under these parameters, their omission prevents assessment of whether the ~360° tuning is robust or specific to an unstated parameter set.
  2. [Results] Results section (simulation figures): no mesh-convergence test, cell-size sensitivity study, or comparison against an analytical dipolar-coupling model is provided. The central claim that the phase shift is a direct consequence of the altered magnetostatic field therefore rests on unvalidated numerical output whose discretization dependence remains unquantified.
minor comments (2)
  1. [Figures] Figure captions: the domain-wall displacement coordinate should be defined explicitly (e.g., angle or arc length) so that the phase-versus-position curves can be read without reference to the main text.
  2. [Abstract] The abstract states 'approaching 360 degrees' while the main text should report the exact maximum phase excursion obtained for the simulated geometries.

Simulated Author's Rebuttal

2 responses · 0 unresolved

We thank the referee for the constructive comments and the positive assessment of the work's potential significance. We address each major comment point by point below.

read point-by-point responses
  1. Referee: [Methods] Methods section: the saturation magnetization, uniaxial anisotropy constant, exchange stiffness, and Gilbert damping values used for the Bi:YIG films are not stated. Because the dispersion modulation and resulting phase range are obtained by solving the LLG equation under these parameters, their omission prevents assessment of whether the ~360° tuning is robust or specific to an unstated parameter set.

    Authors: The referee is correct that these parameters were not stated in the Methods section of the submitted manuscript. We will revise the manuscript to include a complete specification of all micromagnetic parameters used for the Bi:YIG films (saturation magnetization, uniaxial anisotropy constant, exchange stiffness, and Gilbert damping) so that the simulations can be fully assessed and reproduced. revision: yes

  2. Referee: [Results] Results section (simulation figures): no mesh-convergence test, cell-size sensitivity study, or comparison against an analytical dipolar-coupling model is provided. The central claim that the phase shift is a direct consequence of the altered magnetostatic field therefore rests on unvalidated numerical output whose discretization dependence remains unquantified.

    Authors: We agree that an explicit mesh-convergence or cell-size sensitivity study was not presented. Although the discretization employed is standard for resolving the relevant dipolar fields and exchange lengths in this material, we will add a cell-size sensitivity analysis (e.g., in the supplementary material) to quantify the discretization dependence of the reported phase shifts. A direct analytical model of the full geometry is not straightforward, but we will expand the discussion of the underlying magnetostatic mechanism to better support the numerical results. revision: yes

Circularity Check

0 steps flagged · score 0.0 of 10

No significant circularity; result from direct LLG simulation

full rationale

The paper reports phase modulation as the output of micromagnetic simulations solving the Landau-Lifshitz-Gilbert equation on an explicitly described Bi:YIG geometry with domain-wall displacement. No equations, fitted parameters, or self-citations are shown that would render the reported dispersion change or 360° phase range a direct algebraic consequence of the inputs by construction. The derivation chain is therefore self-contained against external numerical solution of the stated model.

Assumptions & free parameters 0 free parameters · 0 assumptions · 0 invented entities

Only the abstract is available; no explicit free parameters, axioms, or invented entities are stated. The simulation implicitly relies on standard micromagnetic assumptions (LLG equation, effective field terms) that are not enumerated here.

how reviews work

0 comments
Cite this review

Pith. "Pith review of Spin-wave phase modulation using magnetic domain walls in dipolarly coupled structures for non-volatile magnonic computation." pith.science (2026). https://pith.science/paper/I4NOMWOT

@misc{pith2026260603336,
  author       = {Pith},
  title        = {Pith review of: Spin-wave phase modulation using magnetic domain walls in dipolarly coupled structures for non-volatile magnonic computation},
  year         = {2026},
  howpublished = {\url{https://pith.science/paper/I4NOMWOT}},
  note         = {Machine review of arXiv:2606.03336}
}
read the original abstract

A controllable phase shifter is a key component for spin-wave-based logic and information processing devices. Here, we propose a domain-wall-position-controlled spin-wave phase shifter that exploits dipolar coupling between two closely spaced waveguides to enable continuous phase tuning over a range approaching 360degrees while keeping the spin-wave amplitude constant. Using micromagnetic simulations, we model a bias-free hybrid structure composed of a nanoscale waveguide magnetostatically coupled to a half-ring-shaped structure both made from bismuth-doped yttrium iron garnet with strong perpendicular magnetic anisotropy. Displacing a domain wall in the half-ring modulates the dispersion relation in the adjacent straight waveguide due to the changed magnetostatic interaction, providing a compact and dynamically reconfigurable phase-shifting mechanism. This approach offers precise and non-volatile control over spin-wave propagation and is compatible with energy-efficient magnonic logic architectures.

Figures

Figures reproduced from arXiv: 2606.03336 by the authors.

Figure 1
Figure 1. FIG. 1. Spin-wave phase shifter geometry. Schematic top view of the [PITH_FULL_IMAGE:figures/full_fig_p002_1.png] view at source ↗
Figure 2
Figure 2. a illustrates the spatial distribution of the effective magnetic field magnitude Beff in the phase-shifter geometry, focusing on the region where the straight waveguide is dipo￾larly coupled to the half-ring waveguide hosting a DW. For comparison, the effective field profile of an isolated straight waveguide is also shown. In the isolated configuration, the effective field within the straight waveguide is nearly hom… view at source ↗
Figure 3
Figure 3. FIG. 3 [PITH_FULL_IMAGE:figures/full_fig_p004_3.png] view at source ↗

Discussion (0). Continue with ORCID to comment.

Reference graph

Works this paper leans on

57 extracted references · 3 canonical work pages

  1. [1]

    Nature physics ,volume=

    Magnon spintronics ,author=. Nature physics ,volume=. 2015 ,publisher=

  2. [2]

    Journal of Applied Physics ,volume=

    Non-volatile magnonic logic circuits engineering ,author=. Journal of Applied Physics ,volume=. 2011 ,publisher=

  3. [3]

    IEEE Magnetics Letters ,volume=

    Nonlinear spin-wave logic gates ,author=. IEEE Magnetics Letters ,volume=. 2019 ,publisher=

  4. [4]

    Nature communications ,volume=

    All-linear time reversal by a dynamic artificial crystal ,author=. Nature communications ,volume=. 2010 ,publisher=

  5. [5]

    Physical review letters ,volume=

    Magnon straintronics: Reconfigurable spin-wave routing in strain-controlled bilateral magnetic stripes ,author=. Physical review letters ,volume=. 2018 ,publisher=

  6. [6]

    Journal of Physics D: Applied Physics ,volume=

    Magnonic logic circuits ,author=. Journal of Physics D: Applied Physics ,volume=. 2010 ,publisher=

  7. [7]

    2012 ,publisher=

    Magnonics: From fundamentals to applications ,author=. 2012 ,publisher=

  8. [8]

    Nature communications ,volume=

    Magnon transistor for all-magnon data processing ,author=. Nature communications ,volume=. 2014 ,publisher=

Show all 57 references
  1. [9]

    Applied Physics Letters ,volume=

    Realization of spin-wave logic gates ,author=. Applied Physics Letters ,volume=. 2008 ,publisher=

  2. [10]

    Nature communications ,volume=

    Realization of a spin-wave multiplexer ,author=. Nature communications ,volume=. 2014 ,publisher=

  3. [11]

    Applied Physics Letters ,volume=

    Design of a spin-wave majority gate employing mode selection ,author=. Applied Physics Letters ,volume=. 2014 ,publisher=

  4. [12]

    Applied Physics Letters ,volume=

    Propagating spin wave spectroscopy in a permalloy film: A quantitative analysis ,author=. Applied Physics Letters ,volume=. 2003 ,publisher=

  5. [13]

    Applied Physics Letters ,volume=

    Excitation of propagating spin waves with global uniform microwave fields ,author=. Applied Physics Letters ,volume=. 2011 ,publisher=

  6. [14]

    Nature communications ,volume=

    Approaching soft X-ray wavelengths in nanomagnet-based microwave technology ,author=. Nature communications ,volume=. 2016 ,publisher=

  7. [15]

    Journal of Physics D: Applied Physics ,volume=

    Bias-free reconfigurable magnonic phase shifter based on a spin-current controlled ferromagnetic resonator ,author=. Journal of Physics D: Applied Physics ,volume=. 2019 ,publisher=

  8. [16]

    AIP Advances ,volume=

    Bias-free spin-wave phase shifter for magnonic logic ,author=. AIP Advances ,volume=. 2016 ,publisher=

  9. [17]

    Applied Physics Letters ,volume=

    Microscopic nonlinear magnonic phase shifters based on ultrathin films of a magnetic insulator ,author=. Applied Physics Letters ,volume=. 2022 ,publisher=

  10. [18]

    Applied Physics Letters ,volume=

    Induced nonlinear phase shift of spin waves for magnonic logic circuits ,author=. Applied Physics Letters ,volume=. 2021 ,publisher=

  11. [19]

    Applied Physics Letters ,volume=

    Nanoscale spin wave valve and phase shifter ,author=. Applied Physics Letters ,volume=. 2012 ,publisher=

  12. [20]

    Applied Physics Letters ,volume=

    Magnonic crystals-based tunable microwave phase shifters ,author=. Applied Physics Letters ,volume=. 2014 ,publisher=

  13. [21]

    Nature ,volume=

    Neuromorphic computing with nanoscale spintronic oscillators ,author=. Nature ,volume=. 2017 ,publisher=

  14. [22]

    IEEE access ,volume=

    Reservoir computing with spin waves excited in a garnet film ,author=. IEEE access ,volume=. 2018 ,publisher=

  15. [23]

    Nanotechnology ,year=

    Quantized Artificial Neural Networks Implemented with Spintronic Stochastic Computing ,author=. Nanotechnology ,year=

  16. [24]

    arXiv preprint arXiv:2509.18321 ,year=

    All-magnonic neurons for analog artificial neural networks ,author=. arXiv preprint arXiv:2509.18321 ,year=

  17. [25]

    Journal of Applied Physics ,volume=

    Magnonic holographic devices for special type data processing ,author=. Journal of Applied Physics ,volume=. 2013 ,publisher=

  18. [26]

    IEEE Journal on Exploratory Solid-State Computational Devices and Circuits ,volume=

    Magnonic holographic memory: From proposal to device ,author=. IEEE Journal on Exploratory Solid-State Computational Devices and Circuits ,volume=. 2015 ,publisher=

  19. [27]

    Communications Physics ,volume=

    Towards magnonic devices based on voltage-controlled magnetic anisotropy ,author=. Communications Physics ,volume=. 2019 ,publisher=

  20. [28]

    Advanced Electronic Materials ,pages=

    Nonreciprocal Spin Waves in Out-of-Plane Magnetized Coupled Waveguides Reconfigured by Domain Wall Displacements ,author=. Advanced Electronic Materials ,pages=. 2025 ,publisher=

  21. [29]

    Science advances ,volume=

    Reconfigurable nanoscale spin-wave directional coupler ,author=. Science advances ,volume=. 2018 ,publisher=

  22. [30]

    Journal of Applied Physics ,volume=

    Electric field controlled spin waveguide phase shifter in YIG ,author=. Journal of Applied Physics ,volume=. 2018 ,publisher=

  23. [31]

    ACS applied materials & interfaces ,volume=

    Spin-wave phase inverter upon a single nanodefect ,author=. ACS applied materials & interfaces ,volume=. 2019 ,publisher=

  24. [32]

    arXiv preprint arXiv:2402.00586 ,year=

    Spin wave-driven variable-phase mutual synchronization in spin Hall nano-oscillators ,author=. arXiv preprint arXiv:2402.00586 ,year=

  25. [33]

    Politecnico Milano 1863 ,year=

    Magnonic phase shifters for spin based logic devices ,author=. Politecnico Milano 1863 ,year=

  26. [34]

    Applied Physics Letters ,volume=

    Micromagnetic simulations for local phase control of propagating spin waves through voltage-controlled magnetic anisotropy ,author=. Applied Physics Letters ,volume=. 2024 ,publisher=

  27. [35]

    Applied Physics Letters ,volume=

    Phase-resolved optical characterization of nanoscale spin waves ,author=. Applied Physics Letters ,volume=. 2023 ,publisher=

  28. [36]

    Scientific reports ,volume=

    Realization of a micrometre-scale spin-wave interferometer ,author=. Scientific reports ,volume=. 2015 ,publisher=

  29. [37]

    Applied Physics Letters ,volume=

    Control of spin-wave phase and wavelength by electric current on the microscopic scale ,author=. Applied Physics Letters ,volume=. 2009 ,publisher=

  30. [38]

    Physical Review B—Condensed Matter and Materials Physics ,volume=

    Resonant and nonresonant scattering of dipole-dominated spin waves from a region of inhomogeneous magnetic field in a ferromagnetic film ,author=. Physical Review B—Condensed Matter and Materials Physics ,volume=. 2007 ,publisher=

  31. [39]

    Science ,volume=

    Mutual control of coherent spin waves and magnetic domain walls in a magnonic device ,author=. Science ,volume=. 2019 ,publisher=

  32. [40]

    Advanced Materials ,volume=

    Electric-field control of propagating spin waves by ferroelectric domain-wall motion in a multiferroic heterostructure ,author=. Advanced Materials ,volume=. 2021 ,publisher=

  33. [41]

    Chinese Physics B ,volume=

    Spin waves and transverse domain walls driven by spin waves: Role of damping ,author=. Chinese Physics B ,volume=. 2020 ,publisher=

  34. [42]

    Physical review letters ,volume=

    All-magnonic spin-transfer torque and domain wall propagation ,author=. Physical review letters ,volume=. 2011 ,publisher=

  35. [43]

    Physical review letters ,volume=

    Domain-wall induced phase shifts in spin waves ,author=. Physical review letters ,volume=. 2004 ,publisher=

  36. [44]

    Physical review letters ,volume=

    Chirality-dependent transmission of spin waves through domain walls ,author=. Physical review letters ,volume=. 2016 ,publisher=

  37. [45]

    Nature Nanotechnology ,volume=

    Coherent magnon-induced domain-wall motion in a magnetic insulator channel ,author=. Nature Nanotechnology ,volume=. 2023 ,publisher=

  38. [46]

    Scientific reports ,volume=

    Ferromagnetic domain walls as spin wave filters and the interplay between domain walls and spin waves ,author=. Scientific reports ,volume=. 2018 ,publisher=

  39. [47]

    Physical Review B—Condensed Matter and Materials Physics ,volume=

    Interaction between propagating spin waves and domain walls on a ferromagnetic nanowire ,author=. Physical Review B—Condensed Matter and Materials Physics ,volume=. 2012 ,publisher=

  40. [48]

    AIP advances ,volume=

    The design and verification of MuMax3 ,author=. AIP advances ,volume=. 2014 ,publisher=

  41. [49]

    Applied Physics Letters ,volume=

    All-thin-film multilayered multiferroic structures with a slot-line for spin-electromagnetic wave devices ,author=. Applied Physics Letters ,volume=. 2014 ,publisher=

  42. [50]

    Journal of Magnetism and Magnetic Materials ,volume=

    Magnonic crystal-semiconductor heterostructure: Double electric and magnetic fields control of spin waves properties ,author=. Journal of Magnetism and Magnetic Materials ,volume=. 2020 ,publisher=

  43. [51]

    arXiv preprint arXiv:2604.19164 ,year=

    Coherent Microwave Driving of Domain Wall Depinning in a Ferrimagnetic Garnet ,author=. arXiv preprint arXiv:2604.19164 ,year=

  44. [52]

    Science ,volume=

    Nanoscale imaging and control of domain-wall hopping with a nitrogen-vacancy center microscope ,author=. Science ,volume=. 2014 ,publisher=

  45. [53]

    Science ,volume=

    Current-controlled magnetic domain-wall nanowire shift register ,author=. Science ,volume=. 2008 ,publisher=

  46. [54]

    science ,volume=

    Magnetic domain-wall racetrack memory ,author=. science ,volume=. 2008 ,publisher=

  47. [55]

    Nature communications ,volume=

    High-speed domain wall racetracks in a magnetic insulator ,author=. Nature communications ,volume=. 2019 ,publisher=

  48. [56]

    Chinese Physics B ,volume=

    The 50 nm-thick yttrium iron garnet films with perpendicular magnetic anisotropy ,author=. Chinese Physics B ,volume=. 2022 ,publisher=

  49. [57]

    Journal of Magnetism and Magnetic Materials ,volume=

    Bi-YIG ferrimagnetic insulator nanometer films with large perpendicular magnetic anisotropy and narrow ferromagnetic resonance linewidth ,author=. Journal of Magnetism and Magnetic Materials ,volume=. 2020 ,publisher=

Pith tools

Reviewed June 28, 2026 · model on record in the stance chip above.